Shri Shiva
श्रीदक्षिणामूर्तिस्तोत्रम् (दक्षिणामूर्त्यष्टकम्)
Dakshinamurti Stotram
आदि शङ्कराचार्य को परम्परा से आरोपित · Traditionally attributed to Ādi Śaṅkarācārya
Continue exploring ↓ · आगे पढ़ें ↓
The Dakṣiṇāmūrti Stotram, also called the Dakṣiṇāmūrty-aṣṭakam, is a hymn of ten verses traditionally attributed to Ādi Śaṅkarācārya, addressed to Śiva as Dakṣiṇāmūrti — the youthful teacher who sits facing south beneath a banyan tree and instructs aged sages in silence. It is at once a hymn and a compact statement of Advaita Vedānta. Each of the first nine verses takes up one line of thought — the world as a reflection seen in a mirror, creation as a sprout latent in a seed, consciousness shining through the senses like lamplight through a pierced pot, the Self that persists through deep sleep and through every stage of life, the eightfold form of the Lord — and closes with the same salutation to the Guru who is Dakṣiṇāmūrti. The tenth verse states the fruit of studying the hymn. Sureśvara, Śaṅkara's disciple, is traditionally credited with an explanatory work on it, the Mānasollāsa. Five short verses of meditation on Dakṣiṇāmūrti, including the well-known 'chitraṃ vaṭataror mūle', are printed after the hymn in the 1912 Bṛhatstotraratnākara and are given in a separate section; in recitation they are often said before it. Every verse is given with Roman transliteration (IAST), a simple pronunciation guide, and Hindi and English meanings.
दक्षिणामूर्तिस्तोत्रम्, जिसे दक्षिणामूर्त्यष्टकम् भी कहते हैं, दस श्लोकों का स्तोत्र है, जिसे परम्परा आदि शङ्कराचार्य की रचना मानती है। यह शिव के दक्षिणामूर्ति रूप को समर्पित है — वह युवा गुरु जो वटवृक्ष के नीचे दक्षिण की ओर मुख करके बैठे हैं और वृद्ध ऋषियों को मौन से उपदेश देते हैं। यह स्तोत्र भी है और अद्वैत वेदान्त का संक्षिप्त प्रतिपादन भी। पहले नौ श्लोकों में से प्रत्येक एक विचार उठाता है — दर्पण में दिखने वाले प्रतिबिम्ब के समान जगत्, बीज में छिपे अंकुर के समान सृष्टि, छिद्रों वाले घड़े से निकलते दीप-प्रकाश की तरह इन्द्रियों से झाँकता चैतन्य, गहरी नींद और जीवन की हर अवस्था में बना रहने वाला आत्मा, और प्रभु की अष्टमूर्ति — और प्रत्येक श्लोक दक्षिणामूर्ति-रूप गुरु को एक ही नमस्कार पर समाप्त होता है। दसवाँ श्लोक स्तोत्र के अध्ययन का फल बताता है। परम्परा के अनुसार शङ्कराचार्य के शिष्य सुरेश्वराचार्य ने इस पर 'मानसोल्लास' नामक व्याख्या-ग्रन्थ लिखा। दक्षिणामूर्ति के ध्यान के पाँच छोटे श्लोक — जिनमें प्रसिद्ध 'चित्रं वटतरोर्मूले' भी है — १९१२ के बृहत्स्तोत्ररत्नाकर में स्तोत्र के बाद छपे हैं; वे अलग खण्ड में दिए गए हैं। पाठ में उन्हें प्रायः स्तोत्र से पहले पढ़ा जाता है। प्रत्येक श्लोक IAST लिप्यन्तरण, सरल उच्चारण तथा हिन्दी और अंग्रेज़ी अर्थ के साथ दिया गया है।
Textual source · पाठ-स्रोत
This is the complete Dakṣiṇāmūrti Stotram, ten verses, followed by five verses of meditation. The ten verses follow Śaṅkarācārya-viracitāni Stotrāṇi, Part 1 (1910), a public-domain edition, as transcribed and proofread on Sanskrit Wikisource. They have been compared verse by verse with three independent witnesses: the Bṛhatstotraratnākara printed in 1912 (scanned text on Sanskrit Wikisource), the hymn as embedded in Sureśvara's Mānasollāsa (Sanskrit Wikisource), and the electronic text of Giridhar Madras on sanskritdocuments.org, used for comparison only and not reproduced here. The four agree closely. In verse 3 the base and the Mānasollāsa read असत्कल्पार्थगं where the other two read असत्कल्पार्थकं; the base reading is kept. Four slips in the transcription were corrected where the other witnesses agree: य: is read यः (verse 2), आश्रितान is read आश्रितान् (verse 3), the dropped त् of जगत् is restored before तस्मै (verse 4), and ध्यानाञ्च is read ध्यानाच्च (verse 10); a missing virāma in मूर्त्यष्टकम् (verse 9) is supplied. The five verses of meditation follow the 1912 Bṛhatstotraratnākara, where they are printed after the hymn as verses 11–15, checked against the same verses in the sanskritdocuments text, which prints them before the hymn in a different order; obvious scanning errors in the 1912 text (such as चटविटपि for वटविटपि) were corrected from it. The English and Hindi introductions above are original writing by AdiVeda; they give context and summary, not a translation of the Sanskrit and not a traditional commentary.
॥ ॐ ॥
Verse meanings · श्लोकार्थप्रत्येक श्लोक के नीचे दिया गया हिन्दी और अंग्रेज़ी अर्थ AdiVeda का अपना सम्पादकीय अनुवाद है, जो ऊपर दिए गए संस्कृत पाठ से सीधे इस संस्करण के लिए किया गया है। यह पाठ को समझने में सहायता के लिए है — यह किसी प्रकाशित अनुवाद का उद्धरण या कोई पारम्परिक भाष्य नहीं है। जहाँ विभिन्न परम्पराएँ किसी अंश को अलग ढंग से पढ़ती हैं, वहाँ संक्षेप में यह बताया गया है।
The Hindi and English meaning under each verse is AdiVeda's own editorial translation, made directly from the Sanskrit printed here for this edition. It is meant to help you follow the text — it is not quoted from any published translation and it is not a traditional commentary. Where traditions read a passage differently, the meaning says so briefly.
दक्षिणामूर्तिस्तोत्रम् · The hymn (verses 1–10)
विश्वं दर्पणदृश्यमाननगरीतुल्यं निजान्तर्गतं
पश्यन्नात्मनि मायया बहिरिवोद्भूतं यथा निद्रया ।
यः साक्षात्कुरुते प्रबोधसमये स्वात्मानमेवाद्वयं
तस्मै श्रीगुरुमूर्तये नम इदं श्रीदक्षिणामूर्तये ॥ १ ॥
viśvaṃ darpaṇadṛśyamānanagarītulyaṃ nijāntargataṃ
paśyannātmani māyayā bahirivodbhūtaṃ yathā nidrayā,
yaḥ sākṣātkurute prabodhasamaye svātmānamevādvayaṃ
tasmai śrīgurumūrtaye nama idaṃ śrīdakṣiṇāmūrtaye || 1 ||
Vishvam darpanadrishyamaananagariitulyam nijaantargatam pashyannaatmani maayayaa bahirivodbhuutam yathaa nidrayaa, yah saakshaatkurute prabodhasamaye svaatmaanamevaadvayam tasmai shriigurumuurtaye nama idam shriidakshinaamuurtaye
जो अपने ही भीतर स्थित, दर्पण में दिखने वाले नगर के समान इस विश्व को — जैसे निद्रा में (स्वप्न) बाहर उत्पन्न हुआ-सा दिखता है वैसे ही — माया के कारण अपने आत्मा में बाहर प्रकट हुआ-सा देखता है, और जागने (ज्ञान के उदय) के समय अपने अद्वितीय आत्मा का ही साक्षात्कार करता है — उन श्रीगुरु-मूर्ति श्रीदक्षिणामूर्ति को यह नमस्कार है।
He sees this universe — which lies within himself, like a city seen in a mirror — as though it had arisen outside, through māyā, just as things seem to in sleep; and at the moment of awakening he realises his own Self, one without a second. To him, embodied as the Guru, to Śrī Dakṣiṇāmūrti, this salutation.
बीजस्यान्तरिवाङ्कुरो जगदिदं प्राङ्निर्विकल्पं पुन-
र्मायाकल्पितदेशकालकलनावैचित्र्यचित्रीकृतम् ।
मायावीव विजृम्भयत्यपि महायोगीव यः स्वेच्छया
तस्मै श्रीगुरुमूर्तये नम इदं श्रीदक्षिणामूर्तये ॥ २ ॥
bījasyāntarivāṅkuro jagadidaṃ prāṅnirvikalpaṃ puna-
rmāyākalpitadeśakālakalanāvaicitryacitrīkṛtam,
māyāvīva vijṛmbhayatyapi mahāyogīva yaḥ svecchayā
tasmai śrīgurumūrtaye nama idaṃ śrīdakṣiṇāmūrtaye || 2 ||
Biijasyaantarivaankuro jagadidam praannirvikalpam puna- rmaayaakalpitadeshakaalakalanaavaichitryachitriikritam, maayaaviiva vijrimbhayatyapi mahaayogiiva yah svechchhayaa tasmai shriigurumuurtaye nama idam shriidakshinaamuurtaye
यह जगत् पहले (सृष्टि से पूर्व) बीज के भीतर अंकुर की तरह निर्विकल्प (अविभक्त) था; फिर माया द्वारा कल्पित देश, काल और गणना की विविधता से चित्रित हो गया। जो जादूगर की तरह, या महायोगी की तरह, अपनी इच्छा से इसे फैलाते हैं — उन श्रीगुरु-मूर्ति श्रीदक्षिणामूर्ति को यह नमस्कार है।
Before creation this world lay undifferentiated, like the sprout within a seed; afterwards it became variegated by the diversity of space, time and reckoning imagined through māyā. He who unfolds it at his own will, like a magician or like a great yogī — to him, embodied as the Guru, to Śrī Dakṣiṇāmūrti, this salutation.
यस्यैव स्फुरणं सदात्मकमसत्कल्पार्थगं भासते
साक्षात्तत्त्वमसीति वेदवचसा यो बोधयत्याश्रितान् ।
यत्साक्षात्करणाद्भवेन्न पुनरावृत्तिर्भवाम्भोनिधौ
तस्मै श्रीगुरुमूर्तये नम इदं श्रीदक्षिणामूर्तये ॥ ३ ॥
yasyaiva sphuraṇaṃ sadātmakamasatkalpārthagaṃ bhāsate
sākṣāttattvamasīti vedavacasā yo bodhayatyāśritān,
yatsākṣātkaraṇādbhavenna punarāvṛttirbhavāmbhonidhau
tasmai śrīgurumūrtaye nama idaṃ śrīdakṣiṇāmūrtaye || 3 ||
Yasyaiva sphuranam sadaatmakamasatkalpaarthagam bhaasate saakshaattattvamasiiti vedavachasaa yo bodhayatyaashritaan, yatsaakshaatkaranaadbhavenna punaraavrittirbhavaambhonidhau tasmai shriigurumuurtaye nama idam shriidakshinaamuurtaye
जिनका ही प्रकाश, जो सत्-स्वरूप है, असत् के समान (मिथ्या) पदार्थों में जाता हुआ भासित होता है; जो शरण में आए लोगों को "तत्त्वमसि" (वह तू है) — इस वेद-वाक्य से साक्षात् बोध कराते हैं; और जिनके साक्षात्कार से संसार-सागर में फिर लौटना नहीं होता — उन श्रीगुरु-मूर्ति श्रीदक्षिणामूर्ति को यह नमस्कार है।
His radiance alone, which is Being itself, shines as it reaches out to objects that are as good as unreal; he awakens those who come to him directly through the Vedic words "That thou art"; and once he is realised there is no returning to the ocean of worldly existence. To him, embodied as the Guru, to Śrī Dakṣiṇāmūrti, this salutation.
नानाच्छिद्रघटोदरस्थितमहादीपप्रभाभास्वरं
ज्ञानं यस्य तु चक्षुरादिकरणद्वारा बहिः स्पन्दते ।
जानामीति तमेव भान्तमनुभात्येतत्समस्तं जग-
त्तस्मै श्रीगुरुमूर्तये नम इदं श्रीदक्षिणामूर्तये ॥ ४ ॥
nānācchidraghaṭodarasthitamahādīpaprabhābhāsvaraṃ
jñānaṃ yasya tu cakṣurādikaraṇadvārā bahiḥ spandate,
jānāmīti tameva bhāntamanubhātyetatsamastaṃ jaga-
ttasmai śrīgurumūrtaye nama idaṃ śrīdakṣiṇāmūrtaye || 4 ||
Naanaachchhidraghatodarasthitamahaadiipaprabhaabhaasvaram jnaanam yasya tu chakshuraadikaranadvaaraa bahih spandate, jaanaamiiti tameva bhaantamanubhaatyetatsamastam jaga- ttasmai shriigurumuurtaye nama idam shriidakshinaamuurtaye
अनेक छिद्रों वाले घड़े के भीतर रखे बड़े दीपक के प्रकाश की तरह चमकने वाला जिनका ज्ञान आँख आदि इन्द्रियों के द्वारों से बाहर फैलता है; "मैं जानता हूँ" — इस रूप में प्रकाशित होते हुए उन्हीं के पीछे यह समस्त जगत् प्रकाशित होता है — उन श्रीगुरु-मूर्ति श्रीदक्षिणामूर्ति को यह नमस्कार है।
His knowing, bright as the light of a great lamp set inside a pot pierced with many holes, streams outward through the doors of the eye and the other senses; as he shines in the form "I know", this whole world shines after him. To him, embodied as the Guru, to Śrī Dakṣiṇāmūrti, this salutation.
देहं प्राणमपीन्द्रियाण्यपि चलां बुद्धिं च शून्यं विदुः
स्त्रीबालान्धजडोपमास्त्वहमिति भ्रान्ता भृशं वादिनः ।
मायाशक्तिविलासकल्पितमहाव्यामोहसंहारिणे
तस्मै श्रीगुरुमूर्तये नम इदं श्रीदक्षिणामूर्तये ॥ ५ ॥
dehaṃ prāṇamapīndriyāṇyapi calāṃ buddhiṃ ca śūnyaṃ viduḥ
strībālāndhajaḍopamāstvahamiti bhrāntā bhṛśaṃ vādinaḥ,
māyāśaktivilāsakalpitamahāvyāmohasaṃhāriṇe
tasmai śrīgurumūrtaye nama idaṃ śrīdakṣiṇāmūrtaye || 5 ||
Deham praanamapiindriyaanyapi chalaam buddhim cha shuunyam viduh striibaalaandhajadopamaastvahamiti bhraantaa bhrisham vaadinah, maayaashaktivilaasakalpitamahaavyaamohasamhaarine tasmai shriigurumuurtaye nama idam shriidakshinaamuurtaye
कुछ वादी शरीर को, कुछ प्राण को, कुछ इन्द्रियों को, कुछ चंचल बुद्धि को और कुछ शून्य को "मैं" (आत्मा) मानते हैं; वे अत्यन्त भ्रम में हैं और स्त्री, बालक, अन्धे और जड़ के समान (बिना विचार के) बोलते हैं। माया-शक्ति की लीला से कल्पित इस महान् मोह का नाश करने वाले उन श्रीगुरु-मूर्ति श्रीदक्षिणामूर्ति को यह नमस्कार है।
Disputants take the body, or the breath, or the senses, or the fickle intellect, or the void, to be the "I"; they are deeply confused, and speak like women, children, the blind and the dull (the stock comparison of the time for those who do not reason). To him who destroys this great delusion, conjured by the play of the power of māyā — to him, embodied as the Guru, to Śrī Dakṣiṇāmūrti, this salutation.
राहुग्रस्तदिवाकरेन्दुसदृशो मायासमाच्छादना-
त्सन्मात्रः करणोपसंहरणतो योऽभूत्सुषुप्तः पुमान् ।
प्रागस्वाप्समिति प्रबोधसमये यः प्रत्यभिज्ञायते
तस्मै श्रीगुरुमूर्तये नम इदं श्रीदक्षिणामूर्तये ॥ ६ ॥
rāhugrastadivākarendusadṛśo māyāsamācchādanā-
tsanmātraḥ karaṇopasaṃharaṇato yo'bhūtsuṣuptaḥ pumān,
prāgasvāpsamiti prabodhasamaye yaḥ pratyabhijñāyate
tasmai śrīgurumūrtaye nama idaṃ śrīdakṣiṇāmūrtaye || 6 ||
Raahugrastadivaakarendusadrisho maayaasamaachchhaadanaa- tsanmaatrah karanopasamharanato yo'bhuutsushuptah pumaan, praagasvaapsamiti prabodhasamaye yah pratyabhijnaayate tasmai shriigurumuurtaye nama idam shriidakshinaamuurtaye
राहु से ग्रस्त सूर्य और चन्द्र के समान, माया से ढका होने के कारण, इन्द्रियों के समेट लिए जाने से जो पुरुष गहरी नींद (सुषुप्ति) में केवल सत्-मात्र रह गया था, और जागने पर "मैं पहले सोया था" — इस रूप में जिसकी पहचान होती है — उन श्रीगुरु-मूर्ति श्रीदक्षिणामूर्ति को यह नमस्कार है।
Like the sun or moon swallowed by Rāhu in an eclipse, veiled by māyā, the person who in deep sleep, when the senses were withdrawn, remained as pure Being alone, and who on waking is recognised in the thought "I slept before" — to him, embodied as the Guru, to Śrī Dakṣiṇāmūrti, this salutation.
बाल्यादिष्वपि जाग्रदादिषु तथा सर्वास्ववस्थास्वपि
व्यावृत्तास्वनुवर्तमानमहमित्यन्तः स्फुरन्तं सदा ।
स्वात्मानं प्रकटीकरोति भजतां यो मुद्रया भद्रया
तस्मै श्रीगुरुमूर्तये नम इदं श्रीदक्षिणामूर्तये ॥ ७ ॥
bālyādiṣvapi jāgradādiṣu tathā sarvāsvavasthāsvapi
vyāvṛttāsvanuvartamānamahamityantaḥ sphurantaṃ sadā,
svātmānaṃ prakaṭīkaroti bhajatāṃ yo mudrayā bhadrayā
tasmai śrīgurumūrtaye nama idaṃ śrīdakṣiṇāmūrtaye || 7 ||
Baalyaadishvapi jaagradaadishu tathaa sarvaasvavasthaasvapi vyaavrittaasvanuvartamaanamahamityantah sphurantam sadaa, svaatmaanam prakatiikaroti bhajataam yo mudrayaa bhadrayaa tasmai shriigurumuurtaye nama idam shriidakshinaamuurtaye
बचपन आदि (आयु की अवस्थाओं) में, जाग्रत् आदि (चेतना की अवस्थाओं) में — इन सब बदलती अवस्थाओं में जो "मैं" के रूप में भीतर सदा बना रहता और स्फुरित होता है, उस अपने आत्मा को जो अपनी मंगलमयी (ज्ञान-)मुद्रा से भक्तों के सामने प्रकट कर देते हैं — उन श्रीगुरु-मूर्ति श्रीदक्षिणामूर्ति को यह नमस्कार है।
Through childhood and the other ages of life, through waking and the other states — through all these states that come and go — there is that which continues and always shines within as "I". He reveals this, one's own Self, to those who worship him, by his auspicious gesture (the cin-mudrā). To him, embodied as the Guru, to Śrī Dakṣiṇāmūrti, this salutation.
विश्वं पश्यति कार्यकारणतया स्वस्वामिसंबन्धतः
शिष्याचार्यतया तथैव पितृपुत्राद्यात्मना भेदतः ।
स्वप्ने जाग्रति वा य एष पुरुषो मायापरिभ्रामित-
स्तस्मै श्रीगुरुमूर्तये नम इदं श्रीदक्षिणामूर्तये ॥ ८ ॥
viśvaṃ paśyati kāryakāraṇatayā svasvāmisaṃbandhataḥ
śiṣyācāryatayā tathaiva pitṛputrādyātmanā bhedataḥ,
svapne jāgrati vā ya eṣa puruṣo māyāparibhrāmita-
stasmai śrīgurumūrtaye nama idaṃ śrīdakṣiṇāmūrtaye || 8 ||
Vishvam pashyati kaaryakaaranatayaa svasvaamisambandhatah shishyaachaaryatayaa tathaiva pitriputraadyaatmanaa bhedatah, svapne jaagrati vaa ya esha purusho maayaaparibhraamita- stasmai shriigurumuurtaye nama idam shriidakshinaamuurtaye
स्वप्न में हो या जाग्रत् में, माया से भ्रमित यह पुरुष विश्व को भेद के रूप में देखता है — कार्य और कारण के रूप में, स्व (सम्पत्ति) और स्वामी के सम्बन्ध के रूप में, शिष्य और आचार्य के रूप में, और उसी प्रकार पिता और पुत्र आदि के रूप में — (उस भ्रम को दूर करने वाले) उन श्रीगुरु-मूर्ति श्रीदक्षिणामूर्ति को यह नमस्कार है।
In dream or in waking, this person, set spinning by māyā, sees the universe in terms of difference — as cause and effect, as owner and owned, as disciple and teacher, and likewise as father and son and the like. To him (who removes this confusion), embodied as the Guru, to Śrī Dakṣiṇāmūrti, this salutation.
भूरम्भांस्यनलोऽनिलोऽम्बरमहर्नाथो हिमांशुः पुमा-
नित्याभाति चराचरात्मकमिदं यस्यैव मूर्त्यष्टकम् ।
नान्यत्किंचन विद्यते विमृशतां यस्मात्परस्माद्विभो-
स्तस्मै श्रीगुरुमूर्तये नम इदं श्रीदक्षिणामूर्तये ॥ ९ ॥
bhūrambhāṃsyanalo'nilo'mbaramaharnātho himāṃśuḥ pumā-
nityābhāti carācarātmakamidaṃ yasyaiva mūrtyaṣṭakam,
nānyatkiṃcana vidyate vimṛśatāṃ yasmātparasmādvibho-
stasmai śrīgurumūrtaye nama idaṃ śrīdakṣiṇāmūrtaye || 9 ||
Bhuurambhaamsyanalo'nilo'mbaramaharnaatho himaamshuh pumaa- nityaabhaati charaacharaatmakamidam yasyaiva muurtyashtakam, naanyatkimchana vidyate vimrishataam yasmaatparasmaadvibho- stasmai shriigurumuurtaye nama idam shriidakshinaamuurtaye
पृथ्वी, जल, अग्नि, वायु, आकाश, सूर्य, चन्द्रमा और पुरुष (यजमान) — इस रूप में चर-अचर से युक्त यह (जगत्) जिनकी ही आठ मूर्तियों के रूप में भासित होता है; विचार करने वालों के लिए जिन परम, सर्वव्यापी प्रभु से भिन्न कुछ भी विद्यमान नहीं है — उन श्रीगुरु-मूर्ति श्रीदक्षिणामूर्ति को यह नमस्कार है।
Earth, the waters, fire, wind, space, the sun, the moon and the person (the sacrificer) — as these, this world of moving and unmoving things appears as nothing but his eight forms; and for those who reflect, nothing whatever exists apart from him, the supreme, all-pervading Lord. To him, embodied as the Guru, to Śrī Dakṣiṇāmūrti, this salutation.
सर्वात्मत्वमिति स्फुटीकृतमिदं यस्मादमुष्मिंस्तवे
तेनास्य श्रवणात्तदर्थमननाद्ध्यानाच्च संकीर्तनात् ।
सर्वात्मत्वमहाविभूतिसहितं स्यादीश्वरत्वं स्वतः
सिध्येत्तत्पुनरष्टधा परिणतं चैश्वर्यमव्याहतम् ॥ १० ॥
sarvātmatvamiti sphuṭīkṛtamidaṃ yasmādamuṣmiṃstave
tenāsya śravaṇāttadarthamananāddhyānācca saṃkīrtanāt,
sarvātmatvamahāvibhūtisahitaṃ syādīśvaratvaṃ svataḥ
sidhyettatpunaraṣṭadhā pariṇataṃ caiśvaryamavyāhatam || 10 ||
Sarvaatmatvamiti sphutiikritamidam yasmaadamushmimstave tenaasya shravanaattadarthamananaaddhyaanaachcha samkiirtanaat, sarvaatmatvamahaavibhuutisahitam syaadiishvaratvam svatah sidhyettatpunarashtadhaa parinatam chaishvaryamavyaahatam
क्योंकि इस स्तोत्र में "सब कुछ आत्मा ही है" — यह स्पष्ट किया गया है, इसलिए इसे सुनने से, इसके अर्थ का मनन करने से, ध्यान से और कीर्तन से सर्वात्मभाव की महान् विभूति के साथ ईश्वरत्व अपने-आप प्राप्त होता है, और आठ प्रकार में परिणत अबाध ऐश्वर्य (अणिमा आदि सिद्धियाँ) भी सिद्ध होता है।
Because this hymn makes plain that the Self is all, by hearing it, reflecting on its meaning, meditating on it and reciting it, lordship comes of itself, together with the great glory of being the Self of all; and the unobstructed sovereignty that unfolds in eight ways (the eight powers such as aṇimā) is also attained.
ध्यानश्लोकाः · Verses of meditation (printed after the hymn)
वटविटपिसमीपे भूमिभागे निषण्णं
सकलमुनिजनानां ज्ञानदातारमारात् ।
त्रिभुवनगुरुमीशं दक्षिणामूर्तिदेवं
जननमरणदुःखच्छेददक्षं नमामि ॥ १ ॥
vaṭaviṭapisamīpe bhūmibhāge niṣaṇṇaṃ
sakalamunijanānāṃ jñānadātāramārāt,
tribhuvanagurumīśaṃ dakṣiṇāmūrtidevaṃ
jananamaraṇaduḥkhacchedadakṣaṃ namāmi || 1 ||
Vatavitapisamiipe bhuumibhaage nishannam sakalamunijanaanaam jnaanadaataaramaaraat, tribhuvanagurumiisham dakshinaamuurtidevam jananamaranaduhkhachchhedadaksham namaami
वटवृक्ष के समीप भूमि पर बैठे हुए, पास बैठे सभी मुनियों को ज्ञान देने वाले, तीनों लोकों के गुरु, जन्म-मरण के दुःख को काटने में दक्ष, प्रभु दक्षिणामूर्ति देव को मैं नमस्कार करता हूँ।
Seated on the ground beside the banyan tree, giving knowledge to all the sages gathered near him, teacher of the three worlds, skilled in cutting away the sorrow of birth and death — to the Lord, the god Dakṣiṇāmūrti, I bow.
चित्रं वटतरोर्मूले वृद्धाः शिष्या गुरुर्युवा ।
गुरोस्तु मौनं व्याख्यानं शिष्यास्तु छिन्नसंशयाः ॥ २ ॥
citraṃ vaṭatarormūle vṛddhāḥ śiṣyā gururyuvā,
gurostu maunaṃ vyākhyānaṃ śiṣyāstu chinnasaṃśayāḥ || 2 ||
Chitram vatatarormuule vriddhaah shishyaa gururyuvaa, gurostu maunam vyaakhyaanam shishyaastu chhinnasamshayaah
कैसा आश्चर्य है! वटवृक्ष की जड़ के पास शिष्य वृद्ध हैं और गुरु युवा; गुरु का व्याख्यान मौन है, फिर भी शिष्यों के संशय कट गए हैं।
How wonderful! At the foot of the banyan tree the disciples are old and the teacher is young; the teacher's exposition is silence, yet the disciples' doubts are cut away.
ॐ नमः प्रणवार्थाय शुद्धज्ञानैकमूर्तये ।
निर्मलाय प्रशान्ताय दक्षिणामूर्तये नमः ॥ ३ ॥
oṃ namaḥ praṇavārthāya śuddhajñānaikamūrtaye,
nirmalāya praśāntāya dakṣiṇāmūrtaye namaḥ || 3 ||
Om namah pranavaarthaaya shuddhajnaanaikamuurtaye, nirmalaaya prashaantaaya dakshinaamuurtaye namah
ॐ — प्रणव के अर्थ-स्वरूप, शुद्ध ज्ञान की एकमात्र मूर्ति, निर्मल और परम शान्त दक्षिणामूर्ति को नमस्कार है।
Oṃ — salutation to Dakṣiṇāmūrti, who is the meaning of the syllable Oṃ, the one embodiment of pure knowledge, spotless and wholly at peace.
निधये सर्वविद्यानां भिषजे भवरोगिणाम् ।
गुरवे सर्वलोकानां दक्षिणामूर्तये नमः ॥ ४ ॥
nidhaye sarvavidyānāṃ bhiṣaje bhavarogiṇām,
gurave sarvalokānāṃ dakṣiṇāmūrtaye namaḥ || 4 ||
Nidhaye sarvavidyaanaam bhishaje bhavaroginaam, gurave sarvalokaanaam dakshinaamuurtaye namah
सभी विद्याओं के भण्डार, संसार-रूपी रोग से पीड़ितों के वैद्य, और सब लोकों के गुरु दक्षिणामूर्ति को नमस्कार है।
Salutation to Dakṣiṇāmūrti, the treasury of all knowledge, the physician of those sick with worldly existence, the teacher of all the worlds.
मौनव्याख्याप्रकटितपरब्रह्मतत्त्वं युवानं
वर्षिष्ठान्तेवसदृषिगणैरावृतं ब्रह्मनिष्ठैः ।
आचार्येन्द्रं करकलितचिन्मुद्रमानन्दरूपं
स्वात्मारामं मुदितवदनं दक्षिणामूर्तिमीडे ॥ ५ ॥
maunavyākhyāprakaṭitaparabrahmatattvaṃ yuvānaṃ
varṣiṣṭhāntevasadṛṣigaṇairāvṛtaṃ brahmaniṣṭhaiḥ,
ācāryendraṃ karakalitacinmudramānandarūpaṃ
svātmārāmaṃ muditavadanaṃ dakṣiṇāmūrtimīḍe || 5 ||
Maunavyaakhyaaprakatitaparabrahmatattvam yuvaanam varshishthaantevasadrishiganairaavritam brahmanishthaih, aachaaryendram karakalitachinmudramaanandaruupam svaatmaaraamam muditavadanam dakshinaamuurtimiide
जो मौन व्याख्या से परब्रह्म-तत्त्व को प्रकट करते हैं, जो युवा हैं, ब्रह्मनिष्ठ, अत्यन्त वृद्ध शिष्य ऋषियों से घिरे हैं; जो आचार्यों में श्रेष्ठ हैं, हाथ में चिन्मुद्रा धारण किए हैं, आनन्द-स्वरूप हैं, अपने आत्मा में ही रमण करते हैं और प्रसन्न मुख वाले हैं — उन दक्षिणामूर्ति की मैं स्तुति करता हूँ।
He reveals the truth of the supreme Brahman by an exposition made in silence; he is young, surrounded by throngs of aged sage-disciples established in Brahman; he is the foremost of teachers, his hand forming the cin-mudrā, bliss itself, delighting in his own Self, his face serene and glad — Dakṣiṇāmūrti I praise.
