पञ्चदशी

प्रत्येक श्लोक के नीचे दिया गया हिन्दी और अंग्रेज़ी अर्थ AdiVeda का अपना सम्पादकीय अनुवाद है, जो ऊपर दिए गए संस्कृत पाठ से सीधे इस संस्करण के लिए किया गया है। यह पाठ को समझने में सहायता के लिए है — यह किसी प्रकाशित अनुवाद का उद्धरण या कोई पारम्परिक भाष्य नहीं है। जहाँ विभिन्न परम्पराएँ किसी अंश को अलग ढंग से पढ़ती हैं, वहाँ संक्षेप में यह बताया गया है।

The Hindi and English meaning under each verse is AdiVeda's own editorial translation, made directly from the Sanskrit printed here for this edition. It is meant to help you follow the text — it is not quoted from any published translation and it is not a traditional commentary. Where traditions read a passage differently, the meaning says so briefly.

नमः श्रीशङ्करानन्दगुरुपादाम्बुजन्मने
सविलासमहामोहग्राहग्रासैककर्मणे ॥ १ ॥

namaḥ śrīśaṅkarānandagurupādāmbujanmane
savilāsamahāmohagrāhagrāsaikakarmaṇe || 1 ||

Namah shriishankaraanandagurupaadaambujanmane savilaasamahaamohagraahagraasaikakarmane

श्री शङ्करानन्द गुरु के चरण-कमलों को नमस्कार, जिनका एक ही काम है विलास सहित महामोह रूपी ग्राह को निगल जाना।

Salutation to the lotus feet of the teacher Śrī Śaṅkarānanda, whose one work is to swallow whole the crocodile of great delusion together with all its play.

तत्पदाम्बुरुहद्वन्द्वसेवानिर्मलचेतसाम्
सुखबोधाय तत्त्वस्य विवेकोऽयं विधीयते ॥ २ ॥

tatpadāmburuhadvandvasevānirmalacetasām
sukhabodhāya tattvasya viveko'yaṃ vidhīyate || 2 ||

Tatpadaamburuhadvandvasevaanirmalachetasaam sukhabodhaaya tattvasya viveko'yam vidhiiyate

उनके चरण-कमल-युगल की सेवा से जिनका चित्त निर्मल हो चुका है, उनके सुखपूर्वक बोध के लिए तत्त्व का यह विवेक किया जा रहा है।

For the easy understanding of those whose minds have been made clean by serving that pair of lotus feet, this discernment of the truth is undertaken.

शब्दस्पर्शादयो वेद्या वैचित्र्याज्जागरे पृथक्
ततो विभक्ता तत्संविदैकरूप्यान्न भिद्यते ॥ ३ ॥

śabdasparśādayo vedyā vaicitryājjāgare pṛthak
tato vibhaktā tatsaṃvidaikarūpyānna bhidyate || 3 ||

Shabdasparshaadayo vedyaa vaichitryaajjaagare prithak tato vibhaktaa tatsamvidaikaruupyaanna bhidyate

जाग्रत् अवस्था में शब्द, स्पर्श आदि विषय अपनी विचित्रता के कारण एक-दूसरे से अलग जाने जाते हैं; पर उनसे अलग रहने वाली उनकी संवित् (जानने वाली चेतना) एकरूप होने के कारण भिन्न नहीं होती।

In waking, sound, touch and the rest are known as separate from one another because of their variety; but the awareness of them, which stands apart from them, is of one form and is not divided.

तथा स्वप्नेऽत्र वेद्यं तु न स्थिरं जागरे स्थिरम्
तद्भेदोऽतस्तयोस्संविदेकरूपा न भिद्यते ॥ ४ ॥

tathā svapne'tra vedyaṃ tu na sthiraṃ jāgare sthiram
tadbhedo'tastayossaṃvidekarūpā na bhidyate || 4 ||

Tathaa svapne'tra vedyam tu na sthiram jaagare sthiram tadbhedo'tastayossamvidekaruupaa na bhidyate

स्वप्न में भी ऐसा ही है; अन्तर केवल इतना कि वहाँ का विषय स्थिर नहीं, जाग्रत् का स्थिर है। इस प्रकार उन दोनों (अवस्थाओं) का भेद विषय में है, संवित् तो एकरूप है, वह भिन्न नहीं होती।

So too in dream, save that there the object is not stable while in waking it is; the difference between the two states lies in the object, for the awareness is of one form and is not divided.

सुप्तोत्थितस्य सौषुप्ततमो बोधो भवेत् स्मृतिः
सा चाऽवबुद्धाविषयाऽवबुद्धं तत्तदा तमः ॥ ५ ॥

suptotthitasya sauṣuptatamo bodho bhavet smṛtiḥ
sā cā'vabuddhāviṣayā'vabuddhaṃ tattadā tamaḥ || 5 ||

Suptotthitasya saushuptatamo bodho bhavet smritih saa chaa'vabuddhaavishayaa'vabuddham tattadaa tamah

सोकर उठे हुए व्यक्ति को 'मैं सुख से सोया, कुछ नहीं जाना' — यह सुषुप्ति के तम का बोध स्मृति के रूप में होता है। और वह स्मृति उसी की होती है जो अनुभूत हो; अतः उस समय वह तम अनुभूत था।

One who has risen from sleep has a memory of the darkness of deep sleep; and memory is only of what was experienced, so that darkness was itself experienced at the time.

स बोधो विषयाद्भिन्नो न बोधात्स्वप्नबोधवत्
एवं स्थानत्रयेऽप्येका संवित्तद्वद्दिनान्तरे ॥ ६ ॥

sa bodho viṣayādbhinno na bodhātsvapnabodhavat
evaṃ sthānatraye'pyekā saṃvittadvaddināntare || 6 ||

Sa bodho vishayaadbhinno na bodhaatsvapnabodhavat evam sthaanatraye'pyekaa samvittadvaddinaantare

वह बोध अपने विषय से भिन्न है, पर बोध से भिन्न नहीं — जैसे स्वप्न का बोध। इस प्रकार तीनों अवस्थाओं में संवित् एक ही है, और वैसे ही दूसरे दिनों में भी।

That awareness is other than its object but not other than awareness itself, as the awareness in dream is; thus one and the same awareness runs through all three states, and likewise through other days.

मासाब्दयुगकल्पेषु गतागतेष्वनेकधा
नोदेति नाऽस्तमेत्येका संविदेषा स्वयम्प्रभा ॥ ७ ॥

māsābdayugakalpeṣu gatāgateṣvanekadhā
nodeti nā'stametyekā saṃvideṣā svayamprabhā || 7 ||

Maasaabdayugakalpeshu gataagateshvanekadhaa nodeti naa'stametyekaa samvideshaa svayamprabhaa

मास, वर्ष, युग और कल्प अनेक प्रकार से आते-जाते हैं, पर यह एक संवित् न उदित होती है न अस्त होती है; यह स्वयं-प्रकाश है।

Months, years, ages and world-periods come and go in many ways, but this one awareness neither rises nor sets: it shines by its own light.

इयमात्मा परानन्दः परप्रेमास्पदं यतः
मा न भुवं हि भूयासमिति प्रेमात्मनीक्ष्यते ॥ ८ ॥

iyamātmā parānandaḥ parapremāspadaṃ yataḥ
mā na bhuvaṃ hi bhūyāsamiti premātmanīkṣyate || 8 ||

Iyamaatmaa paraanandah parapremaaspadam yatah maa na bhuvam hi bhuuyaasamiti premaatmaniikshyate

यही आत्मा परम आनन्द है, क्योंकि यही सबसे ऊँचे प्रेम का आश्रय है — 'मैं न होऊँ ऐसा न हो, मैं सदा रहूँ' — इस रूप में अपने प्रति प्रेम देखा जाता है।

This Self is the highest bliss, because it is the object of the highest love: 'may I never not be, may I always be' — such is the love seen towards oneself.

तत्प्रेमार्थमन्यत्र नैवमन्यार्थमात्मनः
अतस्तत्परमं तेन परमानन्दताऽत्मनः ॥ ९ ॥

tatpremārthamanyatra naivamanyārthamātmanaḥ
atastatparamaṃ tena paramānandatā'tmanaḥ || 9 ||

Tatpremaarthamanyatra naivamanyaarthamaatmanah atastatparamam tena paramaanandataa'tmanah

अन्य वस्तुओं के प्रति प्रेम उस (आत्मा) के लिए होता है, आत्मा के प्रति प्रेम किसी और के लिए नहीं; अतः वह सर्वोपरि है, और इसीलिए आत्मा परमानन्द-रूप है।

Love for other things is for the sake of the Self, but love for the Self is not for the sake of anything else; therefore it is supreme, and therefore the Self is the highest bliss.

इत्थं सच्चित्परानन्द आत्मा युक्त्या तथाविधम्
परं ब्रह्म तयोश्चैक्यं श्रुत्यन्तेषूपदिश्यते ॥ १० ॥

itthaṃ saccitparānanda ātmā yuktyā tathāvidham
paraṃ brahma tayoścaikyaṃ śrutyanteṣūpadiśyate || 10 ||

Ittham sachchitparaananda aatmaa yuktyaa tathaavidham param brahma tayoshchaikyam shrutyanteshuupadishyate

इस प्रकार युक्ति से आत्मा सत्, चित् और परम आनन्द सिद्ध होता है; परब्रह्म भी वैसा ही है, और उन दोनों की एकता वेदान्त में उपदिष्ट है।

Thus by reasoning the Self is established as being, awareness and highest bliss; the supreme Brahman is of the same nature, and the Upaniṣads teach the oneness of the two.

अभाने न परं प्रेम भाने न विषये स्पृहा
अतो भानेऽप्यभाताऽसौ परमानन्दताऽत्मनः ॥ ११ ॥

abhāne na paraṃ prema bhāne na viṣaye spṛhā
ato bhāne'pyabhātā'sau paramānandatā'tmanaḥ || 11 ||

Abhaane na param prema bhaane na vishaye sprihaa ato bhaane'pyabhaataa'sau paramaanandataa'tmanah

जो भासित न हो उसके प्रति परम प्रेम नहीं होता, और जो भासित हो उस विषय में स्पृहा नहीं रहती; अतः भासित होते हुए भी आत्मा की यह परमानन्दता अभासित-सी रहती है।

There is no supreme love for what does not shine forth, and no craving for an object once it has shone forth fully; so, though the Self shines, this its highest bliss remains as if unshining.

अध्येतृवर्गमध्यस्थपुत्राध्ययनशब्दवत्
भानेऽप्यभानं भानस्य प्रतिबन्धेन युज्यते ॥ १२ ॥

adhyetṛvargamadhyasthaputrādhyayanaśabdavat
bhāne'pyabhānaṃ bhānasya pratibandhena yujyate || 12 ||

Adhyetrivargamadhyasthaputraadhyayanashabdavat bhaane'pyabhaanam bhaanasya pratibandhena yujyate

जैसे पढ़ने वालों के समूह के बीच बैठे हुए पिता को अपने पुत्र के पाठ का शब्द सुनाई देते हुए भी सुनाई नहीं देता, वैसे ही भासित होते हुए भी भासन का न होना प्रतिबन्ध के कारण बनता है।

As a father seated amid a group of reciting students does not hear his own son's voice though it is sounding, so a thing may shine and yet not shine, because of an obstruction.

प्रतिबन्धोऽस्ति भातीति व्यवहारार्हवस्तुनि
तन्निरस्य विरुद्धस्य तस्योत्पादनमुच्यते ॥ १३ ॥

pratibandho'sti bhātīti vyavahārārhavastuni
tannirasya viruddhasya tasyotpādanamucyate || 13 ||

Pratibandho'sti bhaatiiti vyavahaaraarhavastuni tannirasya viruddhasya tasyotpaadanamuchyate

प्रतिबन्ध उसी वस्तु में माना जाता है जो 'है' और 'भासती है' — जो व्यवहार के योग्य हो। उसे हटाकर उसके विरुद्ध (अभाव या अभान) को उत्पन्न करना ही प्रतिबन्ध कहलाता है।

An obstruction is spoken of only where a thing both is and shines, that is, where it is fit for dealings; to set that aside and produce its opposite is what is called obstruction.

तस्य हेतुस्समानाभिहारः पुत्रध्वनिश्रुतौ
इहाऽनादिरविद्यैव व्यामोहैकनिबन्धनम् ॥ १४ ॥

tasya hetussamānābhihāraḥ putradhvaniśrutau
ihā'nādiravidyaiva vyāmohaikanibandhanam || 14 ||

Tasya hetussamaanaabhihaarah putradhvanishrutau ihaa'naadiravidyaiva vyaamohaikanibandhanam

पुत्र की ध्वनि के सुनने में उस प्रतिबन्ध का कारण समान शब्दों का एक साथ आ पड़ना है; यहाँ (आत्मा के विषय में) अनादि अविद्या ही व्यामोह का एकमात्र कारण है।

In the case of hearing the son's voice the cause of that obstruction is the crowding together of like sounds; here, in the case of the Self, beginningless nescience alone is the one ground of bewilderment.

चिदानन्दमयब्रह्मप्रतिबिम्बसमन्विता
तमोरजस्सत्वगुणा प्रकृतिर्द्विविधा च सा ॥ १५ ॥

cidānandamayabrahmapratibimbasamanvitā
tamorajassatvaguṇā prakṛtirdvividhā ca sā || 15 ||

Chidaanandamayabrahmapratibimbasamanvitaa tamorajassatvagunaa prakritirdvividhaa cha saa

चिदानन्दमय ब्रह्म के प्रतिबिम्ब से युक्त, तम, रज और सत्त्व — तीन गुणों वाली वह मूल प्रकृति है; और वह दो प्रकार की है।

Endowed with the reflection of Brahman, which is awareness and bliss, and made of the qualities of darkness, energy and clarity, this is nature; and it is of two kinds.

सत्त्वशुद्ध्यविशुद्धिभ्यां मायाऽविद्ये च ते मते
मायाबिम्बो वशीकृत्य तां स्यात्सर्वज्ञ ईश्वरः ॥ १६ ॥

sattvaśuddhyaviśuddhibhyāṃ māyā'vidye ca te mate
māyābimbo vaśīkṛtya tāṃ syātsarvajña īśvaraḥ || 16 ||

Sattvashuddhyavishuddhibhyaam maayaa'vidye cha te mate maayaabimbo vashiikritya taam syaatsarvajna iishvarah

सत्त्व की शुद्धि और अशुद्धि के भेद से वे दोनों माया और अविद्या मानी जाती हैं। माया में पड़ा प्रतिबिम्ब उसे वश में करके सर्वज्ञ ईश्वर होता है।

By the purity or impurity of its clarity the two are held to be illusion and nescience. The reflection in illusion, holding it in subjection, is the all-knowing Lord.

अविद्यावशगस्त्वन्यस्तद्वैचित्र्यादनेकधा
सा कारणशरीरं स्यात्प्राज्ञस्तत्राऽभिमानवान् ॥ १७ ॥

avidyāvaśagastvanyastadvaicitryādanekadhā
sā kāraṇaśarīraṃ syātprājñastatrā'bhimānavān || 17 ||

Avidyaavashagastvanyastadvaichitryaadanekadhaa saa kaaranashariiram syaatpraajnastatraa'bhimaanavaan

दूसरा (प्रतिबिम्ब) अविद्या के वश में रहता है; उस अविद्या की विचित्रता से वह अनेक प्रकार का होता है। वही अविद्या कारण-शरीर है, और उसमें अभिमान करने वाला प्राज्ञ कहलाता है।

The other reflection is subject to nescience, and through the variety of that nescience it becomes many. That nescience is the causal body, and the one who identifies himself with it is called prājña.

तमःप्रधानप्रकृतेस्तद्भोगायेश्वराज्ञया
वियत्पवनतेजोऽम्बुभुवो भूतानि जज्ञिरे ॥ १८ ॥

tamaḥpradhānaprakṛtestadbhogāyeśvarājñayā
viyatpavanatejo'mbubhuvo bhūtāni jajñire || 18 ||

Tamahpradhaanaprakritestadbhogaayeshvaraajnayaa viyatpavanatejo'mbubhuvo bhuutaani jajnire

तमःप्रधान प्रकृति से, उस (जीव) के भोग के लिए, ईश्वर की आज्ञा से आकाश, वायु, तेज, जल और पृथ्वी — ये भूत उत्पन्न हुए।

From nature in which darkness predominates, for the enjoyment of that soul and by the command of the Lord, there arose the elements: space, air, fire, water and earth.

सत्त्वांशैः पञ्चभिस्तेषां क्रमाद्धीन्द्रियपञ्चकम्
श्रोत्रत्वगक्षिरसनघ्राणाख्यमुपजायते ॥ १९ ॥

sattvāṃśaiḥ pañcabhisteṣāṃ kramāddhīndriyapañcakam
śrotratvagakṣirasanaghrāṇākhyamupajāyate || 19 ||

Sattvaamshaih panchabhisteshaam kramaaddhiindriyapanchakam shrotratvagakshirasanaghraanaakhyamupajaayate

उन भूतों के सत्त्व-अंशों से क्रमशः श्रोत्र, त्वक्, चक्षु, रसना और घ्राण — ये पाँच ज्ञानेन्द्रियाँ उत्पन्न होती हैं।

From the clear portions of those five elements arise, in order, the five organs of knowledge, named ear, skin, eye, tongue and nose.

तैरन्तःकरणं सर्वैर्वृत्तिभेदेन तद्द्विधा
मनो विमर्शरूपं स्याद्बुद्धिस्स्यान्निश्चयात्मिका ॥ २० ॥

tairantaḥkaraṇaṃ sarvairvṛttibhedena taddvidhā
mano vimarśarūpaṃ syādbuddhissyānniścayātmikā || 20 ||

Tairantahkaranam sarvairvrittibhedena taddvidhaa mano vimarsharuupam syaadbuddhissyaannishchayaatmikaa

उन सबके (सत्त्व-अंशों के) मिलने से अन्तःकरण बनता है; वृत्ति के भेद से वह दो प्रकार का है — विमर्श-रूप मन और निश्चय-रूप बुद्धि।

From all those portions together arises the inner organ; by difference of function it is twofold — mind, whose nature is deliberating, and intellect, whose nature is deciding.

रजोऽम्शैः पञ्चभिस्तेषां क्रमात्कर्मेन्द्रियाणि तु
वाक्पाणिपादपायूपस्थाभिधानानि जज्ञिरे ॥ २१ ॥

rajo'mśaiḥ pañcabhisteṣāṃ kramātkarmendriyāṇi tu
vākpāṇipādapāyūpasthābhidhānāni jajñire || 21 ||

Rajo'mshaih panchabhisteshaam kramaatkarmendriyaani tu vaakpaanipaadapaayuupasthaabhidhaanaani jajnire

उन भूतों के पाँच रजोंशों से क्रमशः वाक्, पाणि, पाद, पायु और उपस्थ नाम वाली कर्मेन्द्रियाँ उत्पन्न हुईं।

From the five energetic portions of those elements arose, in order, the organs of action named speech, hand, foot, anus and generative organ.

तैस्सर्वैस्सहितैः प्राणो वृत्तिभेदात्स पञ्चधा
प्राणोपानस्समानश्चोदानव्यानौ च ते पुनः ॥ २२ ॥

taissarvaissahitaiḥ prāṇo vṛttibhedātsa pañcadhā
prāṇopānassamānaścodānavyānau ca te punaḥ || 22 ||

Taissarvaissahitaih praano vrittibhedaatsa panchadhaa praanopaanassamaanashchodaanavyaanau cha te punah

उन सब (रजोंशों) के मिलने से प्राण बनता है; वृत्ति के भेद से वह पाँच प्रकार का है — प्राण, अपान, समान, तथा उदान और व्यान।

From all those portions together arises the vital breath; by difference of function it is fivefold — prāṇa, apāna, samāna, and udāna and vyāna.

बुद्धिकर्मेन्द्रियप्राणपञ्चकैर्मनसा धिया
शरीरं सप्तदशभिस्सूक्ष्मं तल्लिङ्गमुच्यते ॥ २३ ॥

buddhikarmendriyaprāṇapañcakairmanasā dhiyā
śarīraṃ saptadaśabhissūkṣmaṃ talliṅgamucyate || 23 ||

Buddhikarmendriyapraanapanchakairmanasaa dhiyaa shariiram saptadashabhissuukshmam tallingamuchyate

पाँच ज्ञानेन्द्रियों, पाँच कर्मेन्द्रियों और पाँच प्राणों के साथ मन और बुद्धि — इन सत्रह से बना सूक्ष्म शरीर 'लिङ्ग-शरीर' कहलाता है।

The subtle body made of these seventeen — the five organs of knowledge, the five of action, the five breaths, with mind and intellect — is called the subtle or mark-body.

प्राज्ञस्तत्राऽभिमानेन तैजसत्वं प्रपद्यते
हिरण्यगर्भतामीशस्तयोर्व्यष्टिसमष्टिता ॥ २४ ॥

prājñastatrā'bhimānena taijasatvaṃ prapadyate
hiraṇyagarbhatāmīśastayorvyaṣṭisamaṣṭitā || 24 ||

Praajnastatraa'bhimaanena taijasatvam prapadyate hiranyagarbhataamiishastayorvyashtisamashtitaa

प्राज्ञ उसमें अभिमान करके तैजस हो जाता है, और ईश्वर हिरण्यगर्भ हो जाता है; उन दोनों में व्यष्टि और समष्टि का भेद है।

Prājña, identifying himself with it, becomes taijasa, and the Lord becomes hiraṇyagarbha; the difference between the two is that of the single and the collective.

समष्टिरीशस्सर्वेषां स्वात्मतादात्म्यवेदनात्
तदभावात्ततोऽन्ये तु कथ्यन्ते व्यष्टिसंज्ञया ॥ २५ ॥

samaṣṭirīśassarveṣāṃ svātmatādātmyavedanāt
tadabhāvāttato'nye tu kathyante vyaṣṭisaṃjñayā || 25 ||

Samashtiriishassarveshaam svaatmataadaatmyavedanaat tadabhaavaattato'nye tu kathyante vyashtisamjnayaa

समष्टि-रूप ईश्वर है, क्योंकि वह सबको अपने से अभिन्न जानता है; उस ज्ञान के अभाव से जो दूसरे हैं वे व्यष्टि नाम से कहे जाते हैं।

The collective is the Lord, because he knows all as not other than himself; those others, in whom that knowledge is absent, are spoken of by the name of the single.

तद्भोगाय पुनर्भोग्यभोगायतनजन्मने
पञ्चीकरोति भगवान् प्रत्येकं वियदादिकम् ॥ २६ ॥

tadbhogāya punarbhogyabhogāyatanajanmane
pañcīkaroti bhagavān pratyekaṃ viyadādikam || 26 ||

Tadbhogaaya punarbhogyabhogaayatanajanmane panchiikaroti bhagavaan pratyekam viyadaadikam

उस (जीव) के भोग के लिए तथा भोग्य वस्तुओं और भोग के आश्रय (शरीर) के जन्म के लिए भगवान् आकाश आदि प्रत्येक भूत का पञ्चीकरण करते हैं।

For that soul's enjoyment, and to bring into being the things enjoyed and the seat of enjoyment, the Lord makes each of the elements, space and the rest, fivefold.

द्विधा विधाय चैकैकं चतुर्धा प्रथमं पुनः
स्वस्वेतरद्वितीयांशैर्योजनात् पञ्च पञ्च ते ॥ २७ ॥

dvidhā vidhāya caikaikaṃ caturdhā prathamaṃ punaḥ
svasvetaradvitīyāṃśairyojanāt pañca pañca te || 27 ||

Dvidhaa vidhaaya chaikaikam chaturdhaa prathamam punah svasvetaradvitiiyaamshairyojanaat pancha pancha te

प्रत्येक को पहले दो भागों में करके, फिर उनमें से एक को चार भागों में करके, और उन अंशों को अपने से इतर चारों के दूसरे अंशों के साथ जोड़ने से वे पाँचों पाँच-पाँच वाले हो जाते हैं।

Dividing each into two, then the first half of each again into four, and joining those quarters to the second halves of the other four, each of the five comes to contain all five.

तैरण्डस्तत्र भुवनं भोग्यभोगाश्रयोद्भवः
हिरण्यगर्भस्स्थूलेऽस्मिन् देहे वैश्वानरो भवेत् ॥ २८ ॥

tairaṇḍastatra bhuvanaṃ bhogyabhogāśrayodbhavaḥ
hiraṇyagarbhassthūle'smin dehe vaiśvānaro bhavet || 28 ||

Tairandastatra bhuvanam bhogyabhogaashrayodbhavah hiranyagarbhassthuule'smin dehe vaishvaanaro bhavet

उन (पञ्चीकृत भूतों) से ब्रह्माण्ड बनता है, उसमें लोक बनते हैं, और भोग्य तथा भोग के आश्रय उत्पन्न होते हैं। इस स्थूल शरीर में हिरण्यगर्भ वैश्वानर कहलाता है।

From them comes the world-egg, and within it the worlds, and the things enjoyed and the seats of enjoyment; in this gross body hiraṇyagarbha becomes vaiśvānara.

तैजसा विश्वतां याता देवतिर्यङ्नरादयः
ते पराग्दर्शिनः प्रत्यक्तत्वबोधविवर्जिताः ॥ २९ ॥

taijasā viśvatāṃ yātā devatiryaṅnarādayaḥ
te parāgdarśinaḥ pratyaktatvabodhavivarjitāḥ || 29 ||

Taijasaa vishvataam yaataa devatiryannaraadayah te paraagdarshinah pratyaktatvabodhavivarjitaah

तैजस जीव विश्व-भाव को प्राप्त होकर देव, तिर्यक् और मनुष्य आदि बनते हैं; वे बाहर की ओर देखने वाले हैं और प्रत्यक् तत्त्व के बोध से रहित हैं।

The taijasa souls, coming to the state of viśva, become gods, animals, human beings and the rest; they look outward and are without the knowledge of the inward truth.

कुर्वते कर्म भोगाय कर्म कर्तुं च भुञ्जते
नद्यां कीटा इवावर्तादावर्तान्तरमाशु ते
व्रजन्तो जन्मनो जन्म लभन्ते नैव निर्वृतिम् ॥ ३० ॥

kurvate karma bhogāya karma kartuṃ ca bhuñjate
nadyāṃ kīṭā ivāvartādāvartāntaramāśu te
vrajanto janmano janma labhante naiva nirvṛtim || 30 ||

Kurvate karma bhogaaya karma kartum cha bhunjate nadyaam kiitaa ivaavartaadaavartaantaramaashu te vrajanto janmano janma labhante naiva nirvritim

वे भोग के लिए कर्म करते हैं और कर्म करने के लिए भोगते हैं; नदी में कीड़े जैसे एक भँवर से दूसरे भँवर में शीघ्र चले जाते हैं, वैसे ही वे एक जन्म से दूसरे जन्म में जाते हुए कभी शान्ति नहीं पाते।

They act in order to enjoy and enjoy in order to act; like insects in a river swept quickly from one whirlpool into the next, they pass from birth to birth and never find peace.

सत्कर्मपरिपाकात्ते करुणानिधिनोद्धृताः
प्राप्य तीरतरुच्छायां विश्राम्यन्ति यथासुखम् ॥ ३१ ॥

satkarmaparipākātte karuṇānidhinoddhṛtāḥ
prāpya tīratarucchāyāṃ viśrāmyanti yathāsukham || 31 ||

Satkarmaparipaakaatte karunaanidhinoddhritaah praapya tiirataruchchhaayaam vishraamyanti yathaasukham

सत्कर्मों के परिपाक से करुणा के निधि (गुरु या ईश्वर) द्वारा उद्धार पाकर, वे तीर के वृक्ष की छाया पाकर सुखपूर्वक विश्राम करते हैं।

When their good deeds ripen they are lifted out by one who is a treasure-house of compassion, and, reaching the shade of a tree on the bank, they rest at ease.

उपदेशमवाप्यैवमाचार्यात्तत्त्वदर्शिनः
पञ्चकोशविवेकेन लभन्ते निर्वृतिं पराम् ॥ ३२ ॥

upadeśamavāpyaivamācāryāttattvadarśinaḥ
pañcakośavivekena labhante nirvṛtiṃ parām || 32 ||

Upadeshamavaapyaivamaachaaryaattattvadarshinah panchakoshavivekena labhante nirvritim paraam

इस प्रकार तत्त्वदर्शी आचार्य से उपदेश पाकर, पञ्चकोश के विवेक से वे परम शान्ति को प्राप्त करते हैं।

Having thus received instruction from a teacher who sees the truth, by the discernment of the five sheaths they attain the highest peace.

अन्नं प्राणो मनो बुद्धिरानन्दश्चेति पञ्च ते
कोशास्तैरावृतस्स्वात्मा विस्मृत्य संसृतिं व्रजेत् ॥ ३३ ॥

annaṃ prāṇo mano buddhirānandaśceti pañca te
kośāstairāvṛtassvātmā vismṛtya saṃsṛtiṃ vrajet || 33 ||

Annam praano mano buddhiraanandashcheti pancha te koshaastairaavritassvaatmaa vismritya samsritim vrajet

अन्न, प्राण, मन, बुद्धि और आनन्द — ये पाँच कोश हैं; उनसे ढका हुआ अपना आत्मा (अपने को) भूलकर संसार में भटकता है।

Food, breath, mind, understanding and bliss — these are the five sheaths; covered by them one's own Self forgets itself and wanders in the round of birth and death.

स्यात्पञ्चीकृतभूतोत्थो देहस्स्थूलोऽन्नसंज्ञकः
लिङ्गं तु राजसैः प्राणैः प्राणः कर्मेन्द्रियैस्सह ॥ ३४ ॥

syātpañcīkṛtabhūtottho dehassthūlo'nnasaṃjñakaḥ
liṅgaṃ tu rājasaiḥ prāṇaiḥ prāṇaḥ karmendriyaissaha || 34 ||

Syaatpanchiikritabhuutottho dehassthuulo'nnasamjnakah lingam tu raajasaih praanaih praanah karmendriyaissaha

पञ्चीकृत भूतों से बना स्थूल शरीर 'अन्नमय' कहलाता है; राजस प्राणों के साथ कर्मेन्द्रियों से युक्त प्राण 'प्राणमय' है, जो लिङ्ग-शरीर में है।

The gross body arising from the fivefold-compounded elements is called the sheath of food; the breath, with the energetic vital airs and the organs of action, is the sheath of breath, which belongs to the subtle body.

सात्त्विकैर्धीन्द्रियैस्साकं विमर्शात्मा मनोमयः
तैरेव साकं विज्ञानमयो धीर्निश्चयात्मिका ॥ ३५ ॥

sāttvikairdhīndriyaissākaṃ vimarśātmā manomayaḥ
taireva sākaṃ vijñānamayo dhīrniścayātmikā || 35 ||

Saattvikairdhiindriyaissaakam vimarshaatmaa manomayah taireva saakam vijnaanamayo dhiirnishchayaatmikaa

सात्त्विक ज्ञानेन्द्रियों के साथ विमर्श-स्वरूप मन 'मनोमय' कोश है; उन्हीं के साथ निश्चय-स्वरूप बुद्धि 'विज्ञानमय' कोश है।

With the clear organs of knowledge, the deliberating mind is the sheath made of mind; with the same organs, the deciding intellect is the sheath made of understanding.

कारणे सत्त्वमानन्दमयो मोदादिवृत्तिभिः
तत्तत्कोशैस्तु तादात्म्यादात्मा तत्तन्मयो भवेत् ॥ ३६ ॥

kāraṇe sattvamānandamayo modādivṛttibhiḥ
tattatkośaistu tādātmyādātmā tattanmayo bhavet || 36 ||

Kaarane sattvamaanandamayo modaadivrittibhih tattatkoshaistu taadaatmyaadaatmaa tattanmayo bhavet

कारण-शरीर में मोद आदि वृत्तियों के साथ सत्त्व 'आनन्दमय' कोश है। उन-उन कोशों से तादात्म्य के कारण आत्मा उन-उन रूप हो जाता है।

In the causal body, clarity with its functions of joy and the rest is the sheath made of bliss. Through identification with each of these sheaths the Self takes on the nature of each.

अन्वयव्यतिरेकाभ्यां पञ्चकोशविवेकतः
स्वात्मानं तत उद्धृत्य परं ब्रह्म प्रपद्यते ॥ ३७ ॥

anvayavyatirekābhyāṃ pañcakośavivekataḥ
svātmānaṃ tata uddhṛtya paraṃ brahma prapadyate || 37 ||

Anvayavyatirekaabhyaam panchakoshavivekatah svaatmaanam tata uddhritya param brahma prapadyate

अन्वय और व्यतिरेक के द्वारा पञ्चकोश के विवेक से अपने आत्मा को उनसे निकालकर मनुष्य परब्रह्म को प्राप्त करता है।

By presence and absence, through the discernment of the five sheaths, one lifts one's own Self out from them and reaches the supreme Brahman.

अभाने स्थूलदेहस्य स्वप्ने यद्भानमात्मनः
सोऽन्वयो व्यतिरेकस्तद्भानेऽन्यानवभासनम् ॥ ३८ ॥

abhāne sthūladehasya svapne yadbhānamātmanaḥ
so'nvayo vyatirekastadbhāne'nyānavabhāsanam || 38 ||

Abhaane sthuuladehasya svapne yadbhaanamaatmanah so'nvayo vyatirekastadbhaane'nyaanavabhaasanam

स्वप्न में स्थूल देह के न भासने पर भी आत्मा का जो भान होता है, वह अन्वय है; और आत्मा के भासने पर दूसरों का न भासना व्यतिरेक है।

That the Self shines in dream although the gross body does not shine is its presence; that when the Self shines the rest do not shine is its absence.

लिङ्गाभाने सुषुप्तौ स्यादात्मनो भानमन्वयः
व्यतिरेकस्तु तद्भाने लिङ्गस्याभानमुच्यते ॥ ३९ ॥

liṅgābhāne suṣuptau syādātmano bhānamanvayaḥ
vyatirekastu tadbhāne liṅgasyābhānamucyate || 39 ||

Lingaabhaane sushuptau syaadaatmano bhaanamanvayah vyatirekastu tadbhaane lingasyaabhaanamuchyate

सुषुप्ति में लिङ्ग-शरीर के न भासने पर भी आत्मा का भासना अन्वय है; और आत्मा के भासने पर लिङ्ग-शरीर का न भासना व्यतिरेक कहलाता है।

That the Self shines in deep sleep although the subtle body does not shine is its presence; that when the Self shines the subtle body does not shine is called its absence.

तद्विवेकाद्विविक्तास्स्युः कोशाः प्राणमनोधियः
ते हि तत्र गुणावस्थाभेदमात्रात्पृथक्कृताः ॥ ४० ॥

tadvivekādviviktāssyuḥ kośāḥ prāṇamanodhiyaḥ
te hi tatra guṇāvasthābhedamātrātpṛthakkṛtāḥ || 40 ||

Tadvivekaadviviktaassyuh koshaah praanamanodhiyah te hi tatra gunaavasthaabhedamaatraatprithakkritaah

उसी विवेक से प्राण, मन और बुद्धि — ये कोश अलग-अलग हो जाते हैं; वे तो वहाँ गुण और अवस्था के भेद मात्र से ही पृथक् किए गए हैं।

By that same discernment the sheaths of breath, mind and understanding are separated out; for there they were distinguished only by a difference of quality and condition.

सुषुप्त्यभाने भानन्तु समाधावात्मनोऽन्वयः
व्यतिरेकस्त्वात्मभाने सुषुप्त्यनवभासनम् ॥ ४१ ॥

suṣuptyabhāne bhānantu samādhāvātmano'nvayaḥ
vyatirekastvātmabhāne suṣuptyanavabhāsanam || 41 ||

Sushuptyabhaane bhaanantu samaadhaavaatmano'nvayah vyatirekastvaatmabhaane sushuptyanavabhaasanam

समाधि में सुषुप्ति के न भासने पर भी आत्मा का भासना अन्वय है; और आत्मा के भासने पर सुषुप्ति का न भासना व्यतिरेक है।

In deep meditation the Self shines although deep sleep does not shine — that is its presence; and when the Self shines deep sleep does not shine — that is its absence.

यथा मुञ्जादिषीकैवमात्मा युक्त्या समुद्धृतः
शरीरत्रितयाद्धीरैः परं ब्रह्मैव जायते ॥ ४२ ॥

yathā muñjādiṣīkaivamātmā yuktyā samuddhṛtaḥ
śarīratritayāddhīraiḥ paraṃ brahmaiva jāyate || 42 ||

Yathaa munjaadishiikaivamaatmaa yuktyaa samuddhritah shariiratritayaaddhiiraih param brahmaiva jaayate

जैसे मूँज से सींक निकाली जाती है, वैसे ही धीर पुरुषों द्वारा युक्ति से तीनों शरीरों से निकाला हुआ आत्मा परब्रह्म ही हो जाता है।

As the reed is drawn out from the muñja grass, so the Self, drawn out by reasoning from the three bodies by the steadfast, is nothing other than the supreme Brahman.

परापरात्मनोरेवं युक्त्या संभावितैकता
तत्त्वमस्यादिवाक्यैस्सा भागत्यागेन लक्ष्यते ॥ ४३ ॥

parāparātmanorevaṃ yuktyā saṃbhāvitaikatā
tattvamasyādivākyaissā bhāgatyāgena lakṣyate || 43 ||

Paraaparaatmanorevam yuktyaa sambhaavitaikataa tattvamasyaadivaakyaissaa bhaagatyaagena lakshyate

इस प्रकार युक्ति से पर और अपर आत्मा की एकता सम्भावित की गई; 'तत्त्वमसि' आदि वाक्यों से वह एकता भाग-त्याग-लक्षणा द्वारा लक्षित होती है।

The oneness of the higher and the lower Self, thus made probable by reasoning, is indicated by the sentences 'That thou art' and the rest, through the giving up of a part of the meaning.

जगतो यदुपादानं मायामादाय तामसीम्
निमित्तं शुद्धसत्त्वां तामुच्यते ब्रह्म तद्गिरा ॥ ४४ ॥

jagato yadupādānaṃ māyāmādāya tāmasīm
nimittaṃ śuddhasattvāṃ tāmucyate brahma tadgirā || 44 ||

Jagato yadupaadaanam maayaamaadaaya taamasiim nimittam shuddhasattvaam taamuchyate brahma tadgiraa

तामसी माया को लेकर जो जगत् का उपादान है, और शुद्ध-सत्त्व वाली उसी माया को लेकर जो (जगत् का) निमित्त है, वह ब्रह्म 'तत्' पद से कहा जाता है।

That Brahman which, taking illusion in which darkness predominates, is the material cause of the world, and, taking the same illusion in its pure clarity, is its efficient cause, is spoken of by the word 'That'.

यदा मलिनसत्त्वां तां कामकर्मादिदूषिताम्
आदत्ते तत्परं ब्रह्म त्वंपदेन तदोच्यते ॥ ४५ ॥

yadā malinasattvāṃ tāṃ kāmakarmādidūṣitām
ādatte tatparaṃ brahma tvaṃpadena tadocyate || 45 ||

Yadaa malinasattvaam taam kaamakarmaadiduushitaam aadatte tatparam brahma tvampadena tadochyate

जब वह मलिन सत्त्व वाली, काम और कर्म आदि से दूषित उस (अविद्या) को ग्रहण करता है, तब वही परब्रह्म 'त्वम्' पद से कहा जाता है।

When it takes on that nescience whose clarity is soiled and which is spoiled by desire and action, then the same supreme Brahman is spoken of by the word 'thou'.

त्रितयीमपि तां मुक्त्वा परस्परविरोधिनीम्
अखण्डं सच्चिदानन्दं महावाक्येन लक्ष्यते ॥ ४६ ॥

tritayīmapi tāṃ muktvā parasparavirodhinīm
akhaṇḍaṃ saccidānandaṃ mahāvākyena lakṣyate || 46 ||

Tritayiimapi taam muktvaa parasparavirodhiniim akhandam sachchidaanandam mahaavaakyena lakshyate

परस्पर विरोधी उन तीनों (उपाधियों) को छोड़कर, महावाक्य से अखण्ड सच्चिदानन्द लक्षित होता है।

Setting aside those three mutually opposed limitations, the great sentence indicates the undivided being, awareness and bliss.

सोऽयमित्यादिवाक्येषु विरोधात्तदिदन्तयोः
त्यागेन भागयोरेक आश्रयो लक्ष्यते यथा ॥ ४७ ॥

so'yamityādivākyeṣu virodhāttadidantayoḥ
tyāgena bhāgayoreka āśrayo lakṣyate yathā || 47 ||

So'yamityaadivaakyeshu virodhaattadidantayoh tyaagena bhaagayoreka aashrayo lakshyate yathaa

जैसे 'सोऽयम्' आदि वाक्यों में 'तत्' और 'इदम्' के विरोधी अंशों को छोड़कर एक ही आश्रय लक्षित होता है —

As in sentences like 'this is that man' the contradictory parts of 'that' and 'this' are given up and one single substrate is indicated —

मायाऽविद्ये विहायैवमुपाधी परजीवयोः
अखण्डं सच्चिदानन्दं परब्रह्मैव लक्ष्यते ॥ ४८ ॥

māyā'vidye vihāyaivamupādhī parajīvayoḥ
akhaṇḍaṃ saccidānandaṃ parabrahmaiva lakṣyate || 48 ||

Maayaa'vidye vihaayaivamupaadhii parajiivayoh akhandam sachchidaanandam parabrahmaiva lakshyate

वैसे ही पर और जीव की उपाधियों — माया और अविद्या — को छोड़कर अखण्ड सच्चिदानन्द परब्रह्म ही लक्षित होता है।

so, setting aside illusion and nescience, the limitations of the supreme and of the individual, the undivided being, awareness and bliss, the supreme Brahman alone, is indicated.

सविकल्पस्य लक्ष्यत्वे लक्ष्यस्य स्यादवस्तुता
निर्विकल्पस्य लक्ष्यत्वं न दृष्टं न च सम्भवि ॥ ४९ ॥

savikalpasya lakṣyatve lakṣyasya syādavastutā
nirvikalpasya lakṣyatvaṃ na dṛṣṭaṃ na ca sambhavi || 49 ||

Savikalpasya lakshyatve lakshyasya syaadavastutaa nirvikalpasya lakshyatvam na drishtam na cha sambhavi

यदि सविकल्प को लक्ष्य माना जाए तो लक्ष्य अवस्तु हो जाएगा; और निर्विकल्प का लक्ष्यत्व न देखा गया है न सम्भव है — (ऐसी आशङ्का हो तो)।

If what has distinctions were the thing indicated, the thing indicated would be unreal; and that what is free of distinctions should be indicated is neither seen nor possible — so runs the objection.

विकल्पो निर्विकल्पस्य सविकल्पस्य वा भवेत्
आद्ये व्याहतिरन्यत्रानवस्थाऽत्माश्रयादयः ॥ ५० ॥

vikalpo nirvikalpasya savikalpasya vā bhavet
ādye vyāhatiranyatrānavasthā'tmāśrayādayaḥ || 50 ||

Vikalpo nirvikalpasya savikalpasya vaa bhavet aadye vyaahatiranyatraanavasthaa'tmaashrayaadayah

(उत्तर:) विकल्प निर्विकल्प का होगा या सविकल्प का? पहले में व्याघात है; दूसरे में अनवस्था, आत्माश्रय आदि दोष आते हैं।

Would the distinction belong to what is free of distinctions, or to what has them? The first contradicts itself; the second brings infinite regress, self-dependence and the rest.

इदं गुणक्रियाजातिद्रव्यसम्बन्धवस्तुषु
समं तेन स्वरूपस्य सर्वमेतदितीष्यताम् ॥ ५१ ॥

idaṃ guṇakriyājātidravyasambandhavastuṣu
samaṃ tena svarūpasya sarvametaditīṣyatām || 51 ||

Idam gunakriyaajaatidravyasambandhavastushu samam tena svaruupasya sarvametaditiishyataam

यह (दोष) गुण, क्रिया, जाति, द्रव्य और सम्बन्ध — सब वस्तुओं में समान रूप से लागू है; इसलिए मान लेना चाहिए कि यह सब स्वरूप का ही है।

This difficulty applies alike to quality, action, class, substance and relation; so it must be granted that all this belongs to the thing's own nature.

विकल्पतदभावाभ्यामसंस्पृष्टात्मवस्तुनि
विकल्पितत्वलक्ष्यत्वसम्बन्धाद्यास्तु कल्पिताः ॥ ५२ ॥

vikalpatadabhāvābhyāmasaṃspṛṣṭātmavastuni
vikalpitatvalakṣyatvasambandhādyāstu kalpitāḥ || 52 ||

Vikalpatadabhaavaabhyaamasamsprishtaatmavastuni vikalpitatvalakshyatvasambandhaadyaastu kalpitaah

विकल्प और उसके अभाव — दोनों से अछूती आत्म-वस्तु में विकल्पितत्व, लक्ष्यत्व, सम्बन्ध आदि सब कल्पित ही हैं।

In the reality of the Self, untouched both by distinction and by its absence, being distinguished, being indicated, being related and the rest are all merely imagined.

इत्थं वाक्यैस्तदर्थानुसन्धानं श्रवणं भवेत्
युक्तया सम्भावितत्वानुसन्धानं मननन्तु तत् ॥ ५३ ॥

itthaṃ vākyaistadarthānusandhānaṃ śravaṇaṃ bhavet
yuktayā sambhāvitatvānusandhānaṃ mananantu tat || 53 ||

Ittham vaakyaistadarthaanusandhaanam shravanam bhavet yuktayaa sambhaavitatvaanusandhaanam mananantu tat

इस प्रकार वाक्यों के द्वारा उनके अर्थ का अनुसन्धान श्रवण है; और युक्ति से उसकी सम्भावना का अनुसन्धान मनन है।

Following out the meaning of the sentences in this way is hearing; following out, by reasoning, that the meaning is possible is reflection.

ताभ्यां निर्विचिकित्सेऽर्थे चेतसःस्थापितस्य यत्
एकतानत्वमेतद्धि निदिध्यासनमुच्यते ॥ ५४ ॥

tābhyāṃ nirvicikitse'rthe cetasaḥsthāpitasya yat
ekatānatvametaddhi nididhyāsanamucyate || 54 ||

Taabhyaam nirvichikitse'rthe chetasahsthaapitasya yat ekataanatvametaddhi nididhyaasanamuchyate

इन दोनों से जिस अर्थ में कोई सन्देह न रह गया हो, उसमें स्थापित चित्त का जो एकतानपन है, वही निदिध्यासन कहलाता है।

When by these two the meaning is beyond doubt, the unbroken steadiness of the mind fixed upon it is what is called meditation.

ध्यातृध्याने परित्यज्य क्रमाद्ध्येयैकगोचरम्
निवातदीपवच्चित्तं समाधिरभिधीयते ॥ ५५ ॥

dhyātṛdhyāne parityajya kramāddhyeyaikagocaram
nivātadīpavaccittaṃ samādhirabhidhīyate || 55 ||

Dhyaatridhyaane parityajya kramaaddhyeyaikagocharam nivaatadiipavachchittam samaadhirabhidhiiyate

ध्याता और ध्यान को छोड़कर क्रमशः केवल ध्येय का ही विषय बना हुआ, निर्वात दीपक के समान स्थिर चित्त समाधि कहलाता है।

The mind that has given up the meditator and the meditating, and step by step has only the object of meditation before it, steady as a lamp in a windless place, is called absorption.

वृत्तयस्तु तदानीमज्ञाता अप्यात्मगोचराः
स्मरणादनुमीयन्ते व्युत्थितस्य समुत्थितात् ॥ ५६ ॥

vṛttayastu tadānīmajñātā apyātmagocarāḥ
smaraṇādanumīyante vyutthitasya samutthitāt || 56 ||

Vrittayastu tadaaniimajnaataa apyaatmagocharaah smaranaadanumiiyante vyutthitasya samutthitaat

उस समय वृत्तियाँ जानी नहीं जातीं, पर वे आत्मा को विषय करने वाली होती हैं; समाधि से उठे हुए पुरुष की स्मृति से उनका अनुमान किया जाता है।

At that time the mental movements are not known, yet they have the Self as their object; they are inferred from the memory of one who has risen from that state.

वृत्तीनामनुवृत्तिस्तु प्रयत्नात्प्रथमादपि
अदृष्टासकृदभ्याससंस्कारसचिवाद्भवेत् ॥ ५७ ॥

vṛttīnāmanuvṛttistu prayatnātprathamādapi
adṛṣṭāsakṛdabhyāsasaṃskārasacivādbhavet || 57 ||

Vrittiinaamanuvrittistu prayatnaatprathamaadapi adrishtaasakridabhyaasasamskaarasachivaadbhavet

वृत्तियों की अनुवृत्ति पहले किए गए प्रयत्न से, अदृष्ट और बार-बार के अभ्यास से बने संस्कार की सहायता से होती है।

The continuance of those movements comes from the effort made at first, aided by unseen merit and by the impression left by repeated practice.

यथा दीपो निवातस्थ इत्यादिभिरनेकधा
भगवानिममेवार्थमर्जुनाय न्यरूपयत् ॥ ५८ ॥

yathā dīpo nivātastha ityādibhiranekadhā
bhagavānimamevārthamarjunāya nyarūpayat || 58 ||

Yathaa diipo nivaatastha ityaadibhiranekadhaa bhagavaanimamevaarthamarjunaaya nyaruupayat

'जैसे निर्वात स्थान में रखा दीपक' — इत्यादि अनेक प्रकार से भगवान् ने अर्जुन को यही अर्थ समझाया।

'As a lamp set in a windless place' — in these and many other ways the Lord set out this very matter to Arjuna.

अनादाविह संसारे सञ्चिताः कर्मकोटयः
अनेन विलयं यान्ति शुद्धो धर्मो विवर्धते ॥ ५९ ॥

anādāviha saṃsāre sañcitāḥ karmakoṭayaḥ
anena vilayaṃ yānti śuddho dharmo vivardhate || 59 ||

Anaadaaviha samsaare sanchitaah karmakotayah anena vilayam yaanti shuddho dharmo vivardhate

इस अनादि संसार में संचित करोड़ों कर्म इस (समाधि) से नष्ट हो जाते हैं, और शुद्ध धर्म बढ़ता है।

The countless deeds heaped up in this beginningless round of birth and death are dissolved by it, and pure merit grows.

धर्ममेघमिमं प्राहुस्समाधिं योगवित्तमाः
वर्षत्येष यतो धर्मामृतधारास्सहस्रशः ॥ ६० ॥

dharmameghamimaṃ prāhussamādhiṃ yogavittamāḥ
varṣatyeṣa yato dharmāmṛtadhārāssahasraśaḥ || 60 ||

Dharmameghamimam praahussamaadhim yogavittamaah varshatyesha yato dharmaamritadhaaraassahasrashah

योग के सर्वश्रेष्ठ ज्ञाता इस समाधि को 'धर्ममेघ' कहते हैं, क्योंकि यह हजारों धर्मामृत की धाराएँ बरसाता है।

The best knowers of yoga call this absorption the cloud of merit, because it rains down thousands of streams of the nectar of merit.

अमुना वासनाजाले निश्शेषं प्रविलापिते
समूलोन्मूलिते पुण्यपापाख्ये कर्मसञ्चये ॥ ६१ ॥

amunā vāsanājāle niśśeṣaṃ pravilāpite
samūlonmūlite puṇyapāpākhye karmasañcaye || 61 ||

Amunaa vaasanaajaale nishshesham pravilaapite samuulonmuulite punyapaapaakhye karmasanchaye

इसके द्वारा वासनाओं का जाल पूरी तरह विलीन हो जाने पर, और पुण्य-पाप नामक कर्म-संचय के समूल उखड़ जाने पर —

When by it the net of latent tendencies has been wholly dissolved, and the store of deeds called merit and demerit has been torn up by the root —

वाक्यमप्रतिबद्धं सत् प्राक्परोक्षाऽवभासिते
करामलकवद्बोधमपरोक्षं प्रसूयते ॥ ६२ ॥

vākyamapratibaddhaṃ sat prākparokṣā'vabhāsite
karāmalakavadbodhamaparokṣaṃ prasūyate || 62 ||

Vaakyamapratibaddham sat praakparokshaa'vabhaasite karaamalakavadbodhamaparoksham prasuuyate

पहले परोक्ष रूप से भासित हुआ महावाक्य, अब प्रतिबन्ध-रहित होकर, हथेली पर रखे आँवले के समान अपरोक्ष बोध उत्पन्न करता है।

the sentence, now unobstructed, which before had shone only indirectly, brings forth direct knowledge, as clear as a myrobalan on the palm of the hand.

परोक्षं ब्रह्मविज्ञानं शाब्दं देशिकपूर्वकम्
बुद्धिपूर्वकृतं पापं कृत्स्नं दहति वह्निवत् ॥ ६३ ॥

parokṣaṃ brahmavijñānaṃ śābdaṃ deśikapūrvakam
buddhipūrvakṛtaṃ pāpaṃ kṛtsnaṃ dahati vahnivat || 63 ||

Paroksham brahmavijnaanam shaabdam deshikapuurvakam buddhipuurvakritam paapam kritsnam dahati vahnivat

गुरु के द्वारा शब्द से हुआ ब्रह्म का परोक्ष ज्ञान बुद्धिपूर्वक किए गए समस्त पाप को अग्नि की तरह जला देता है।

Indirect knowledge of Brahman, got from the word through a teacher, burns up like fire the whole of the wrong knowingly done.

अपरोक्षात्मविज्ञानं शाब्दं देशिकपूर्वकम्
संसारकारणाज्ञानतमसश्चण्डभास्करः ॥ ६४ ॥

aparokṣātmavijñānaṃ śābdaṃ deśikapūrvakam
saṃsārakāraṇājñānatamasaścaṇḍabhāskaraḥ || 64 ||

Aparokshaatmavijnaanam shaabdam deshikapuurvakam samsaarakaaranaajnaanatamasashchandabhaaskarah

गुरु के द्वारा शब्द से हुआ आत्मा का अपरोक्ष ज्ञान संसार के कारण अज्ञान-रूपी अन्धकार के लिए प्रचण्ड सूर्य है।

Direct knowledge of the Self, got from the word through a teacher, is a blazing sun to the darkness of the ignorance that causes the round of birth and death.

इत्थं तत्त्वविवेकं विधाय विधिवन्मनस्समाधाय
विगळितसंसृतिबन्धं प्राप्नोति परं पदं नरो न चिरात् ॥ ६५ ॥

itthaṃ tattvavivekaṃ vidhāya vidhivanmanassamādhāya
vigaḻitasaṃsṛtibandhaṃ prāpnoti paraṃ padaṃ naro na cirāt || 65 ||

Ittham tattvavivekam vidhaaya vidhivanmanassamaadhaaya vigalitasamsritibandham praapnoti param padam naro na chiraat

इस प्रकार तत्त्व का विवेक करके और विधिपूर्वक मन को समाहित करके, मनुष्य संसार के बन्धन से मुक्त होकर शीघ्र ही परम पद को प्राप्त करता है।

Having thus discerned the truth and duly gathered the mind, a man, his bondage to the world fallen away, reaches the highest state before long.

सदद्वैतं श्रुतं यत्तत्पञ्चभूतविवेकतः
बोद्धुं शक्यं ततो भूतपञ्चकं प्रविविच्यते ॥ १ ॥

sadadvaitaṃ śrutaṃ yattatpañcabhūtavivekataḥ
boddhuṃ śakyaṃ tato bhūtapañcakaṃ pravivicyate || 1 ||

Sadadvaitam shrutam yattatpanchabhuutavivekatah boddhum shakyam tato bhuutapanchakam pravivichyate

जो सत् अद्वैत श्रुति में सुना गया है, वह पाँच भूतों के विवेक से जाना जा सकता है; इसलिए यहाँ भूत-पञ्चक का विवेचन किया जाता है।

The one reality without a second, which scripture declares, can be understood through the discernment of the five elements; therefore the five elements are here separated out.

शब्दस्पर्शौ रूपरसौ गन्धो भूतगुणा इमे
एकद्वित्रिचतुःपञ्चगुणा व्योमादिषु क्रमात् ॥ २ ॥

śabdasparśau rūparasau gandho bhūtaguṇā ime
ekadvitricatuḥpañcaguṇā vyomādiṣu kramāt || 2 ||

Shabdasparshau ruuparasau gandho bhuutagunaa ime ekadvitrichatuhpanchagunaa vyomaadishu kramaat

शब्द, स्पर्श, रूप, रस और गन्ध — ये भूतों के गुण हैं; आकाश आदि में क्रमशः एक, दो, तीन, चार और पाँच गुण होते हैं।

Sound, touch, form, taste and smell are the qualities of the elements; in space and the rest there are, in order, one, two, three, four and five qualities.

प्रतिध्वनिर्वियच्छब्दो वायौ बीसीति शब्दनम्
अनुष्णाशीतसंस्पर्शो वह्नौ भुगुभुणुध्वनिः ॥ ३ ॥

pratidhvanirviyacchabdo vāyau bīsīti śabdanam
anuṣṇāśītasaṃsparśo vahnau bhugubhuṇudhvaniḥ || 3 ||

Pratidhvanirviyachchhabdo vaayau biisiiti shabdanam anushnaashiitasamsparsho vahnau bhugubhunudhvanih

प्रतिध्वनि आकाश का शब्द है; वायु में 'बीसी' ऐसा शब्द होता है और न गरम न ठंडा स्पर्श होता है; अग्नि में 'भुगुभुणु' ऐसी ध्वनि होती है।

The echo is the sound of space; in air there is the sound 'bīsī' and a touch neither hot nor cold; in fire there is the sound 'bhugubhuṇu'.

उष्णस्पर्शः प्रभारूपं जले बुलबुलुध्वनिः
शीतस्पर्शश्शुक्लरूपं रसो माधुर्यमीरितः ॥ ४ ॥

uṣṇasparśaḥ prabhārūpaṃ jale bulabuludhvaniḥ
śītasparśaśśuklarūpaṃ raso mādhuryamīritaḥ || 4 ||

Ushnasparshah prabhaaruupam jale bulabuludhvanih shiitasparshashshuklaruupam raso maadhuryamiiritah

(अग्नि में) उष्ण स्पर्श और प्रभा-रूप हैं; जल में 'बुलबुलु' ध्वनि, शीतल स्पर्श, श्वेत रूप और मधुर रस कहे गए हैं।

In fire there are hot touch and bright form; in water there are the sound 'bulabulu', cold touch, white form, and taste, said to be sweetness.

भूमौ कडकडाशब्दः काठिन्यं स्पर्श इष्यते
नीलादिकं चित्ररूपं मधुराम्लादिको रसः ॥ ५ ॥

bhūmau kaḍakaḍāśabdaḥ kāṭhinyaṃ sparśa iṣyate
nīlādikaṃ citrarūpaṃ madhurāmlādiko rasaḥ || 5 ||

Bhuumau kadakadaashabdah kaathinyam sparsha ishyate niilaadikam chitraruupam madhuraamlaadiko rasah

पृथ्वी में 'कडकडा' शब्द, कठोरता-रूप स्पर्श, नील आदि विचित्र रूप, और मधुर-अम्ल आदि रस माने जाते हैं।

In earth there are the sound 'kaḍakaḍā', hardness as touch, varied forms such as blue, and tastes sweet, sour and the rest.

सुरभीतरगंधौ द्वौ गुणास्सम्यग्विवेचिताः
श्रोत्रं त्वक्चक्षुषी जिह्वा घ्राणं चेन्द्रियपञ्चकम् ॥ ६ ॥

surabhītaragaṃdhau dvau guṇāssamyagvivecitāḥ
śrotraṃ tvakcakṣuṣī jihvā ghrāṇaṃ cendriyapañcakam || 6 ||

Surabhiitaragamdhau dvau gunaassamyagvivechitaah shrotram tvakchakshushii jihvaa ghraanam chendriyapanchakam

सुगन्ध और दुर्गन्ध — ये दो गुण भी भलीभाँति विवेचित हो गए। श्रोत्र, त्वक्, चक्षु, जिह्वा और घ्राण — ये पाँच इन्द्रियाँ हैं।

The two qualities, fragrance and its opposite, have also been duly set out. Ear, skin, eye, tongue and nose are the five organs.

कर्णादिगोळकस्थं तच्छब्दादिग्राहकं क्रमात्
सौक्ष्म्यात्कार्यानुमेयं तत्प्रायो धावेद्वहिर्मुखम् ॥ ७ ॥

karṇādigoḻakasthaṃ tacchabdādigrāhakaṃ kramāt
saukṣmyātkāryānumeyaṃ tatprāyo dhāvedvahirmukham || 7 ||

Karnaadigolakastham tachchhabdaadigraahakam kramaat saukshmyaatkaaryaanumeyam tatpraayo dhaavedvahirmukham

कान आदि गोलकों में रहकर वे क्रमशः शब्द आदि को ग्रहण करती हैं; सूक्ष्म होने के कारण वे अपने कार्य से अनुमेय हैं, और प्रायः बाहर की ओर दौड़ती हैं।

Seated in the sockets of the ear and the rest, they grasp sound and the rest in order; being subtle they are inferred from their work, and for the most part they run outward.

कदाचित्पिहिते कर्णे श्रूयते शब्द आन्तरः
प्राणवायौ जाठराग्नौ जलपानेऽन्नभक्षणे ॥ ८ ॥

kadācitpihite karṇe śrūyate śabda āntaraḥ
prāṇavāyau jāṭharāgnau jalapāne'nnabhakṣaṇe || 8 ||

Kadaachitpihite karne shruuyate shabda aantarah praanavaayau jaatharaagnau jalapaane'nnabhakshane

कभी कान बन्द करने पर भीतर का शब्द सुनाई देता है; प्राण-वायु में, जठराग्नि में, जल पीने में और अन्न खाने में —

Sometimes, when the ear is stopped, an inner sound is heard; in the vital air, in the fire of the stomach, in drinking water and in eating food —

व्यज्यन्तेह्यान्तरास्पर्शा मीलने चान्तरं तमः
उद्गारे रसगन्धौ चेत्यक्षाणामान्तरग्रहः ॥ ९ ॥

vyajyantehyāntarāsparśā mīlane cāntaraṃ tamaḥ
udgāre rasagandhau cetyakṣāṇāmāntaragrahaḥ || 9 ||

Vyajyantehyaantaraasparshaa miilane chaantaram tamah udgaare rasagandhau chetyakshaanaamaantaragrahah

— भीतरी स्पर्श प्रकट होते हैं; आँख मूँदने पर भीतर का अन्धकार दिखाई देता है; और डकार में रस तथा गन्ध जाने जाते हैं। यह इन्द्रियों का आन्तरिक ग्रहण है।

— inner touches are made plain; on closing the eyes an inner darkness is seen; and in belching taste and smell are known. This is the organs' inward grasping.

पञ्चोक्तयादानगमनविसर्गानन्दकाः क्रियाः
कृषिवाणिज्यसेवाद्याः पञ्चस्वन्तर्भवन्ति हि ॥ १० ॥

pañcoktayādānagamanavisargānandakāḥ kriyāḥ
kṛṣivāṇijyasevādyāḥ pañcasvantarbhavanti hi || 10 ||

Panchoktayaadaanagamanavisargaanandakaah kriyaah krishivaanijyasevaadyaah panchasvantarbhavanti hi

कहना, लेना, चलना, त्याग करना और आनन्द लेना — ये पाँच क्रियाएँ हैं; खेती, व्यापार, सेवा आदि सब इन्हीं पाँचों में समा जाते हैं।

Speaking, taking, going, letting go and enjoying are the five actions; farming, trade, service and the rest are all contained within these five.

वाक्पाणिपादपायूपस्थैरक्षैस्तत्क्रियाजनिः
मुखादिगोळकेष्वास्ते तत्कर्मेन्द्रियपञ्चकम् ॥ ११ ॥

vākpāṇipādapāyūpasthairakṣaistatkriyājaniḥ
mukhādigoḻakeṣvāste tatkarmendriyapañcakam || 11 ||

Vaakpaanipaadapaayuupasthairakshaistatkriyaajanih mukhaadigolakeshvaaste tatkarmendriyapanchakam

वाक्, पाणि, पाद, पायु और उपस्थ — इन इन्द्रियों से उन क्रियाओं की उत्पत्ति होती है; मुख आदि गोलकों में रहने वाली यह कर्मेन्द्रिय-पञ्चक है।

Those actions arise from the organs speech, hand, foot, anus and generative organ; this set of five organs of action abides in the sockets of the mouth and the rest.

मनो दशेन्द्रियाध्यक्षं हृत्पद्मे गोळके स्थितम्
तच्चान्तःकरणं बाह्येष्वस्वातन्त्र्याद्विनेन्द्रियैः ॥ १२ ॥

mano daśendriyādhyakṣaṃ hṛtpadme goḻake sthitam
taccāntaḥkaraṇaṃ bāhyeṣvasvātantryādvinendriyaiḥ || 12 ||

Mano dashendriyaadhyaksham hritpadme golake sthitam tachchaantahkaranam baahyeshvasvaatantryaadvinendriyaih

मन दसों इन्द्रियों का अध्यक्ष है और हृदय-कमल रूपी गोलक में स्थित है; वही अन्तःकरण है, क्योंकि बाहरी विषयों में इन्द्रियों के बिना वह स्वतन्त्र नहीं है।

The mind is the overseer of the ten organs and is seated in the socket that is the lotus of the heart; it is the inner organ, since in outward things it is not independent of the organs.

अक्षेष्वर्थार्पितेष्वेतद्गुणदोषविचारकम्
सत्त्वं रजस्तमश्चास्य गुणा विक्रियते हि तैः ॥ १३ ॥

akṣeṣvarthārpiteṣvetadguṇadoṣavicārakam
sattvaṃ rajastamaścāsya guṇā vikriyate hi taiḥ || 13 ||

Aksheshvarthaarpiteshvetadgunadoshavichaarakam sattvam rajastamashchaasya gunaa vikriyate hi taih

इन्द्रियों के द्वारा विषय सामने रखे जाने पर यह गुण और दोष का विचार करता है; सत्त्व, रज और तम इसके गुण हैं, और उन्हीं से यह विकार को प्राप्त होता है।

When the organs set an object before it, it weighs merit and fault; clarity, energy and darkness are its qualities, and by them it is changed.

वैराग्यं क्षान्तिरौदार्यमित्याद्यास्सत्त्वसम्भवाः
कामक्रोधौ लोभयत्नावित्याद्या रजसोत्थिताः ॥ १४ ॥

vairāgyaṃ kṣāntiraudāryamityādyāssattvasambhavāḥ
kāmakrodhau lobhayatnāvityādyā rajasotthitāḥ || 14 ||

Vairaagyam kshaantiraudaaryamityaadyaassattvasambhavaah kaamakrodhau lobhayatnaavityaadyaa rajasotthitaah

वैराग्य, क्षमा, उदारता आदि सत्त्व से उत्पन्न होते हैं; काम, क्रोध, लोभ और प्रयत्न आदि रजस् से उठते हैं।

Dispassion, patience, generosity and the like arise from clarity; desire, anger, greed and striving and the like spring from energy.

आलस्यं भ्रान्तितन्द्राद्या विकारास्तमसोत्थिताः
सात्विकैः पुण्यनिष्पत्तिः पापोत्पत्तिश्च राजसैः ॥ १५ ॥

ālasyaṃ bhrāntitandrādyā vikārāstamasotthitāḥ
sātvikaiḥ puṇyaniṣpattiḥ pāpotpattiśca rājasaiḥ || 15 ||

Aalasyam bhraantitandraadyaa vikaaraastamasotthitaah saatvikaih punyanishpattih paapotpattishcha raajasaih

आलस्य, भ्रान्ति, तन्द्रा आदि विकार तमस् से उठते हैं। सात्त्विक भावों से पुण्य बनता है और राजस भावों से पाप उत्पन्न होता है।

Sloth, confusion, drowsiness and such changes spring from darkness. From the clear states merit is produced, and from the energetic states demerit.

तामसैर्नोभयं किन्तु वृथायुःक्षपणं भवेत्
अत्राहंप्रत्ययी कर्तेत्येवं लोके व्यवस्थितिः ॥ १६ ॥

tāmasairnobhayaṃ kintu vṛthāyuḥkṣapaṇaṃ bhavet
atrāhaṃpratyayī kartetyevaṃ loke vyavasthitiḥ || 16 ||

Taamasairnobhayam kintu vrithaayuhkshapanam bhavet atraahampratyayii kartetyevam loke vyavasthitih

तामस भावों से इनमें से कुछ भी नहीं होता, केवल आयु व्यर्थ नष्ट होती है। इनमें जिसे 'मैं' की प्रतीति होती है वही कर्ता है — लोक में यही व्यवस्था है।

From the dark states neither of the two comes, only life is wasted away. Among these, the one to whom the notion 'I' belongs is the doer — such is the settled usage of the world.

स्पष्टशब्दादियुक्तेषु भौतिकत्वमतिस्फुटम्
अक्षादावपि तच्छास्त्रयुक्तिभ्यामवधार्यताम् ॥ १७ ॥

spaṣṭaśabdādiyukteṣu bhautikatvamatisphuṭam
akṣādāvapi tacchāstrayuktibhyāmavadhāryatām || 17 ||

Spashtashabdaadiyukteshu bhautikatvamatisphutam akshaadaavapi tachchhaastrayuktibhyaamavadhaaryataam

जिनमें शब्द आदि स्पष्ट हैं उनका भौतिक होना अत्यन्त स्पष्ट है; इन्द्रियों आदि का भी वही (भौतिकपन) शास्त्र और युक्ति से निश्चित करना चाहिए।

In things where sound and the rest are plain, their being made of the elements is quite plain; of the organs too the same should be settled by scripture and reasoning.

एकादशेन्द्रियैर्युक्तया शास्त्रेणाप्यवगम्यते
यावत्किंचिद्भवेदेतदिदंशब्दोदितं जगत् ॥ १८ ॥

ekādaśendriyairyuktayā śāstreṇāpyavagamyate
yāvatkiṃcidbhavedetadidaṃśabdoditaṃ jagat || 18 ||

Ekaadashendriyairyuktayaa shaastrenaapyavagamyate yaavatkimchidbhavedetadidamshabdoditam jagat

ग्यारह इन्द्रियों से, युक्ति से और शास्त्र से भी जो कुछ जाना जाता है — जितना भी 'इदम्' शब्द से कहा जाने वाला यह जगत् है, वह सब यही है।

Whatever is known by the eleven organs, by reasoning and by scripture — all this world, as much of it as the word 'this' names, is just that.

इदं सर्वं पुरा सृष्टेरेकमेवाद्वितीयकम्
सदेवासीन्नामरूपे नास्तामित्यारुणेर्वचः ॥ १९ ॥

idaṃ sarvaṃ purā sṛṣṭerekamevādvitīyakam
sadevāsīnnāmarūpe nāstāmityāruṇervacaḥ || 19 ||

Idam sarvam puraa srishterekamevaadvitiiyakam sadevaasiinnaamaruupe naastaamityaarunervachah

'सृष्टि से पहले यह सब एक ही, अद्वितीय सत् था; नाम और रूप नहीं थे' — यह आरुणि का वचन है।

'Before creation all this was being alone, one only, without a second; name and form were not' — such is the word of Āruṇi.

वृक्षस्य स्वगतो भेदः पत्रपुष्पफलादिभिः
वृक्षान्तरात्सजातीयो विजातीयश्शिलादितः ॥ २० ॥

vṛkṣasya svagato bhedaḥ patrapuṣpaphalādibhiḥ
vṛkṣāntarātsajātīyo vijātīyaśśilāditaḥ || 20 ||

Vrikshasya svagato bhedah patrapushpaphalaadibhih vrikshaantaraatsajaatiiyo vijaatiiyashshilaaditah

वृक्ष का अपने भीतर का भेद पत्ते, फूल, फल आदि से होता है; दूसरे वृक्ष से सजातीय भेद और शिला आदि से विजातीय भेद होता है।

A tree has difference within itself through leaves, flowers, fruit and the rest; difference from another tree of the same kind, and difference from a stone and such of another kind.

तथा सद्वस्तुनो भेदत्रयं प्राप्तं निवार्यते
ऐक्यावधारणद्वैतप्रतिषेधैस्त्रिभिः क्रमात् ॥ २१ ॥

tathā sadvastuno bhedatrayaṃ prāptaṃ nivāryate
aikyāvadhāraṇadvaitapratiṣedhaistribhiḥ kramāt || 21 ||

Tathaa sadvastuno bhedatrayam praaptam nivaaryate aikyaavadhaaranadvaitapratishedhaistribhih kramaat

वैसे ही सत्-वस्तु में जो तीन भेद प्राप्त होते हैं, उनका निवारण क्रमशः तीन बातों से किया जाता है — एकता का निश्चय, 'एक ही', और द्वैत का प्रतिषेध।

So the three kinds of difference that might belong to the reality are set aside in order by three words — the assertion of oneness, 'one only', and the denial of a second.

सतो नावयवाश्शंक्यास्तदंशस्यानिरूपणात्
नामरूपे न तस्यांशौ तयोरद्याप्यनुद्भवात् ॥ २२ ॥

sato nāvayavāśśaṃkyāstadaṃśasyānirūpaṇāt
nāmarūpe na tasyāṃśau tayoradyāpyanudbhavāt || 22 ||

Sato naavayavaashshamkyaastadamshasyaaniruupanaat naamaruupe na tasyaamshau tayoradyaapyanudbhavaat

सत् के अवयव नहीं माने जा सकते, क्योंकि उसका कोई अंश दिखाया नहीं जा सकता; नाम और रूप भी उसके अंश नहीं, क्योंकि तब तक उनका उदय ही नहीं हुआ था।

No parts can be supposed in being, for no part of it can be pointed out; name and form are not its parts, since at that time they had not yet arisen.

नामरूपोद्भवस्यैव सृष्टित्वात्सृष्टितः पुरा
न तयोरुद्भवस्तस्मान्निरंशं सद्यथा वियत् ॥ २३ ॥

nāmarūpodbhavasyaiva sṛṣṭitvātsṛṣṭitaḥ purā
na tayorudbhavastasmānniraṃśaṃ sadyathā viyat || 23 ||

Naamaruupodbhavasyaiva srishtitvaatsrishtitah puraa na tayorudbhavastasmaanniramsham sadyathaa viyat

नाम और रूप का उदय ही तो सृष्टि है; अतः सृष्टि से पहले उनका उदय नहीं था। इसलिए सत् आकाश की तरह निरंश है।

The very arising of name and form is creation; so before creation they had not arisen. Being is therefore without parts, as space is.

सदन्तरं सजातीयं न वैलक्षण्यवर्जनात्
नामरूपोपाधिभेदं विना नैव सतो भिदा ॥ २४ ॥

sadantaraṃ sajātīyaṃ na vailakṣaṇyavarjanāt
nāmarūpopādhibhedaṃ vinā naiva sato bhidā || 24 ||

Sadantaram sajaatiiyam na vailakshanyavarjanaat naamaruupopaadhibhedam vinaa naiva sato bhidaa

सजातीय दूसरा सत् नहीं है, क्योंकि उसमें कोई विलक्षणता नहीं; और नाम-रूप रूपी उपाधि के भेद के बिना सत् में कोई भेद हो ही नहीं सकता।

There is no second being of the same kind, for there is nothing to distinguish it; and without the difference of the limitations of name and form there can be no difference in being at all.

विजातीयमसत्तत्तु न खल्वस्तीति गम्यते
नास्यातः प्रतियोगित्वं विजातीयाद्भिदा कुतः ॥ २५ ॥

vijātīyamasattattu na khalvastīti gamyate
nāsyātaḥ pratiyogitvaṃ vijātīyādbhidā kutaḥ || 25 ||

Vijaatiiyamasattattu na khalvastiiti gamyate naasyaatah pratiyogitvam vijaatiiyaadbhidaa kutah

विजातीय तो असत् होगा, और वह 'है ही नहीं' — ऐसा जाना जाता है; अतः उसका प्रतियोगीपन नहीं बनता, तो विजातीय से भेद कहाँ से हो?

What is of another kind would be non-being, and that is understood simply as not existing; it cannot therefore stand as a counterpart, so whence a difference from what is of another kind?

एकमेवाद्वितीयं सत्सिद्धमत्र तु केचन
विह्वला असदेवेदं पुरासीदित्यवर्णयन् ॥ २६ ॥

ekamevādvitīyaṃ satsiddhamatra tu kecana
vihvalā asadevedaṃ purāsīdityavarṇayan || 26 ||

Ekamevaadvitiiyam satsiddhamatra tu kechana vihvalaa asadevedam puraasiidityavarnayan

इस प्रकार 'एक ही, अद्वितीय सत्' सिद्ध हुआ; पर यहाँ कुछ लोग विह्वल होकर कहते हैं कि 'पहले यह असत् ही था'।

Thus 'being, one only, without a second' is established; yet here some, bewildered, have declared that 'in the beginning this was non-being alone'.

मग्नस्याब्धौ यथाक्षाणि विह्वलानि तथास्य धीः
अखंडैकरसं श्रुत्वा निष्प्रचारा बिभेत्यतः ॥ २७ ॥

magnasyābdhau yathākṣāṇi vihvalāni tathāsya dhīḥ
akhaṃḍaikarasaṃ śrutvā niṣpracārā bibhetyataḥ || 27 ||

Magnasyaabdhau yathaakshaani vihvalaani tathaasya dhiih akhamdaikarasam shrutvaa nishprachaaraa bibhetyatah

जैसे समुद्र में डूबते हुए मनुष्य की इन्द्रियाँ विह्वल हो जाती हैं, वैसे ही इसकी बुद्धि अखण्ड एकरस को सुनकर विह्वल हो जाती है; उसकी गति रुक जाती है और वह डरने लगता है।

As the senses of a man sinking in the sea grow bewildered, so his understanding, hearing of the undivided one taste, is bewildered; its range is cut off and it grows afraid.

गौडाचार्या निर्विकल्पे समाधावन्ययोगिनाम्
साकारब्रह्मनिष्ठानामत्यन्तं भयमूचिरे ॥ २८ ॥

gauḍācāryā nirvikalpe samādhāvanyayoginām
sākārabrahmaniṣṭhānāmatyantaṃ bhayamūcire || 28 ||

Gaudaachaaryaa nirvikalpe samaadhaavanyayoginaam saakaarabrahmanishthaanaamatyantam bhayamuuchire

गौडपादाचार्य ने कहा है कि निर्विकल्प समाधि में साकार ब्रह्म में निष्ठा रखने वाले अन्य योगियों को अत्यन्त भय होता है।

The teacher Gauḍapāda has said that in distinctionless absorption other yogins, who are fixed upon Brahman with form, feel an extreme fear.

अस्पर्शयोगो नामैष दुर्दर्शस्सर्वयोगिभिः
योगिनो बिभ्यति ह्यस्मादभये भयदर्शिनः ॥ २९ ॥

asparśayogo nāmaiṣa durdarśassarvayogibhiḥ
yogino bibhyati hyasmādabhaye bhayadarśinaḥ || 29 ||

Asparshayogo naamaisha durdarshassarvayogibhih yogino bibhyati hyasmaadabhaye bhayadarshinah

यह 'अस्पर्शयोग' नाम का योग है, जो सब योगियों को कठिनता से दिखाई देता है; अभय में भय देखने वाले योगी इससे डरते हैं।

This is the yoga called the touchless, hard for all yogins to see; yogins who see fear where there is no fear are afraid of it.

भगवत्पूज्यपादाश्च शुष्कतर्कपटूनमून्
आहुर्माध्यमिकान्भ्रान्तानचिन्त्येऽस्मिन् सदात्मनि ॥ ३० ॥

bhagavatpūjyapādāśca śuṣkatarkapaṭūnamūn
āhurmādhyamikānbhrāntānacintye'smin sadātmani || 30 ||

Bhagavatpuujyapaadaashcha shushkatarkapatuunamuun aahurmaadhyamikaanbhraantaanachintye'smin sadaatmani

और भगवान् पूज्यपाद ने इन शुष्क तर्क में निपुण माध्यमिकों को इस अचिन्त्य सदात्मा के विषय में भ्रान्त कहा है।

And the revered teacher has called these Mādhyamikas, skilled in dry argument, mistaken about this unthinkable Self that is being.

अनादृत्य श्रुतिं मौर्ख्यादिमे बौद्धास्तमस्विनः
आपेदिरे निरात्मत्वमनुमानैकचक्षुषः ॥ ३१ ॥

anādṛtya śrutiṃ maurkhyādime bauddhāstamasvinaḥ
āpedire nirātmatvamanumānaikacakṣuṣaḥ || 31 ||

Anaadritya shrutim maurkhyaadime bauddhaastamasvinah aapedire niraatmatvamanumaanaikachakshushah

ये तमस् से भरे बौद्ध मूर्खता के कारण श्रुति का आदर न करके, केवल अनुमान को ही आँख मानकर निरात्मवाद तक पहुँच गए।

These Buddhists, full of darkness, through folly paid no regard to scripture, and, taking inference alone for their eye, arrived at the doctrine of no self.

शून्यमासीदितिब्रूषे सद्योगं वा सदात्मताम्
शून्यस्य न तद्युक्तमुभयं व्याहतत्वतः ॥ ३२ ॥

śūnyamāsīditibrūṣe sadyogaṃ vā sadātmatām
śūnyasya na tadyuktamubhayaṃ vyāhatatvataḥ || 32 ||

Shuunyamaasiiditibruushe sadyogam vaa sadaatmataam shuunyasya na tadyuktamubhayam vyaahatatvatah

तुम कहते हो 'शून्य था' — तो क्या शून्य का सत् से योग कहते हो, या शून्य का ही सत्-रूप होना? शून्य के लिए ये दोनों ही ठीक नहीं, क्योंकि दोनों में व्याघात है।

You say 'there was a void'. Do you mean the void joined with being, or the void as itself being? Neither will do for a void, since both contradict themselves.

न युक्तस्तमसा सूर्यो नापि चासौ तमोमयः
सच्छून्ययोर्विरोधित्वाच्छून्यमासीत्कथं वद ॥ ३३ ॥

na yuktastamasā sūryo nāpi cāsau tamomayaḥ
sacchūnyayorvirodhitvācchūnyamāsītkathaṃ vada || 33 ||

Na yuktastamasaa suuryo naapi chaasau tamomayah sachchhuunyayorvirodhitvaachchhuunyamaasiitkatham vada

सूर्य न अन्धकार से युक्त होता है, न वह अन्धकारमय होता है; सत् और शून्य परस्पर विरोधी हैं, तो बताओ 'शून्य था' यह कैसे बने?

The sun is neither joined with darkness nor made of darkness; being and the void are opposed to one another, so tell us how 'there was a void' can stand.

वियदादेर्नामरूपे मायया सुविकल्पिते
शून्यस्य नामरूपे च तथा चेज्जीव्यतां चिरम् ॥ ३४ ॥

viyadādernāmarūpe māyayā suvikalpite
śūnyasya nāmarūpe ca tathā cejjīvyatāṃ ciram || 34 ||

Viyadaadernaamaruupe maayayaa suvikalpite shuunyasya naamaruupe cha tathaa chejjiivyataam chiram

आकाश आदि के नाम और रूप माया से भलीभाँति कल्पित हैं; यदि तुम कहो कि शून्य के भी नाम और रूप वैसे ही हैं, तो चिरकाल जीओ।

The names and forms of space and the rest are well imagined by illusion; if you say the void too has name and form in the same way, then long life to you.

सतोऽपि नामरूपे द्वे कल्पिते चेत्तदा वद
कुत्रेति निरधिष्ठानो न भ्रमः क्वचिदीक्ष्यते ॥ ३५ ॥

sato'pi nāmarūpe dve kalpite cettadā vada
kutreti niradhiṣṭhāno na bhramaḥ kvacidīkṣyate || 35 ||

Sato'pi naamaruupe dve kalpite chettadaa vada kutreti niradhishthaano na bhramah kvachidiikshyate

यदि कहो कि सत् के भी दो — नाम और रूप — कल्पित हैं, तो बताओ किसमें? क्योंकि अधिष्ठान के बिना कहीं भी भ्रम नहीं देखा जाता।

If you say that being too has these two, name and form, imagined in it, then say in what; for nowhere is an error seen without a ground to rest on.

सदासीदिति शब्दार्थभेदे वैगुण्यमापतेत्
अभेदे पुनरुक्तिस्स्यान्मैवं लोके तथेक्षणात् ॥ ३६ ॥

sadāsīditi śabdārthabhede vaiguṇyamāpatet
abhede punaruktissyānmaivaṃ loke tathekṣaṇāt || 36 ||

Sadaasiiditi shabdaarthabhede vaigunyamaapatet abhede punaruktissyaanmaivam loke tathekshanaat

'सत् था' — यदि इन दो शब्दों के अर्थ में भेद माना जाए तो दोष आता है, और अभेद माना जाए तो पुनरुक्ति होती है। ऐसा नहीं, क्योंकि लोक में भी ऐसा ही कहा जाता है।

'Being was' — if the meanings of the two words differ, a fault follows; if they do not, there is mere repetition. Not so, for the world speaks in just this way.

कर्तव्यं कुरुते वाक्यं ब्रूते धार्यस्य धारणम्
इत्यादिवासनाविष्टं प्रत्यासीत्सदितीरणम् ॥ ३७ ॥

kartavyaṃ kurute vākyaṃ brūte dhāryasya dhāraṇam
ityādivāsanāviṣṭaṃ pratyāsītsaditīraṇam || 37 ||

Kartavyam kurute vaakyam bruute dhaaryasya dhaaranam ityaadivaasanaavishtam pratyaasiitsaditiiranam

'करने योग्य को करता है', 'वाक्य को बोलता है', 'धारण करने योग्य का धारण' — ऐसी वासना से भरे हुए (शिष्य) के प्रति ही 'सत् था' यह कहा गया।

'He does what is to be done', 'he speaks the sentence', 'the holding of what is to be held' — it is to one filled with such habits of speech that 'being was' is addressed.

कालाभावे पुरेत्युक्तिः कालवासनया युतम्
शिष्यं प्रत्येव तेनात्र द्वितीयं न हि शंक्यते ॥ ३८ ॥

kālābhāve puretyuktiḥ kālavāsanayā yutam
śiṣyaṃ pratyeva tenātra dvitīyaṃ na hi śaṃkyate || 38 ||

Kaalaabhaave puretyuktih kaalavaasanayaa yutam shishyam pratyeva tenaatra dvitiiyam na hi shamkyate

काल के अभाव में 'पहले' यह कहना काल की वासना वाले शिष्य के प्रति ही है; इसलिए यहाँ किसी दूसरे की शङ्का नहीं की जाती।

Where there is no time, the word 'before' is used only towards a pupil who has the habit of thinking in time; no second thing is therefore to be suspected here.

चोद्यं वा परिहारो वा क्रियतां द्वैतभाषया
अद्वैतभाषया चोद्यं नास्ति नापि तदुत्तरम् ॥ ३९ ॥

codyaṃ vā parihāro vā kriyatāṃ dvaitabhāṣayā
advaitabhāṣayā codyaṃ nāsti nāpi taduttaram || 39 ||

Chodyam vaa parihaaro vaa kriyataam dvaitabhaashayaa advaitabhaashayaa chodyam naasti naapi taduttaram

आपत्ति हो या उसका परिहार — वह द्वैत की भाषा में ही किया जाता है; अद्वैत की भाषा में न कोई आपत्ति है, न उसका उत्तर।

Objection or answer alike must be framed in the language of duality; in the language of non-duality there is neither objection nor reply to it.

तदा स्तिमितगम्भीरं न तेजो न तमस्ततम्
अनाख्यमनभिव्यक्तं सत्किञ्चिदवशिष्यते ॥ ४० ॥

tadā stimitagambhīraṃ na tejo na tamastatam
anākhyamanabhivyaktaṃ satkiñcidavaśiṣyate || 40 ||

Tadaa stimitagambhiiram na tejo na tamastatam anaakhyamanabhivyaktam satkinchidavashishyate

उस समय स्तब्ध और गम्भीर, न तेज न फैला हुआ अन्धकार, अनाख्य और अनभिव्यक्त — कुछ 'सत्' ही शेष रहता है।

Then something remains: being, still and deep, neither light nor spread-out darkness, unnamed and unmanifest.

ननु भूम्यादिकं माभूत्परमाण्वन्तनाशतः
कथं ते वियतोऽसत्त्वं बुद्धिमारोहतीति चेत् ॥ ४१ ॥

nanu bhūmyādikaṃ mābhūtparamāṇvantanāśataḥ
kathaṃ te viyato'sattvaṃ buddhimārohatīti cet || 41 ||

Nanu bhuumyaadikam maabhuutparamaanvantanaashatah katham te viyato'sattvam buddhimaarohatiiti chet

शङ्का: पृथ्वी आदि भले ही न हों, क्योंकि वे परमाणु तक नष्ट हो जाते हैं; पर आकाश का असत्त्व तुम्हारी बुद्धि में कैसे चढ़ता है?

An objection: let earth and the rest not be, since they perish down to the atom; but how does the unreality of space enter your understanding?

अत्यन्तं निर्जगद्व्योम यथा ते बुद्धिमाश्रितम्
तथैव सन्निराकाशं कुतो नाश्रयते मतिम् ॥ ४२ ॥

atyantaṃ nirjagadvyoma yathā te buddhimāśritam
tathaiva sannirākāśaṃ kuto nāśrayate matim || 42 ||

Atyantam nirjagadvyoma yathaa te buddhimaashritam tathaiva sanniraakaasham kuto naashrayate matim

जैसे जगत् से सर्वथा रहित आकाश तुम्हारी बुद्धि में बैठ जाता है, वैसे ही आकाश से रहित सत् तुम्हारी बुद्धि में क्यों नहीं बैठता?

As space wholly without a world settles in your understanding, why should being without space not settle in it in the same way?

निर्जगद्व्योम दृष्टं चेत्प्रकाशतमसी विना
क्व दृष्टं किञ्च ते पक्षे न प्रत्यक्षं वियत्खलु ॥ ४३ ॥

nirjagadvyoma dṛṣṭaṃ cetprakāśatamasī vinā
kva dṛṣṭaṃ kiñca te pakṣe na pratyakṣaṃ viyatkhalu || 43 ||

Nirjagadvyoma drishtam chetprakaashatamasii vinaa kva drishtam kincha te pakshe na pratyaksham viyatkhalu

यदि कहो कि जगत् से रहित आकाश देखा गया है, तो प्रकाश और अन्धकार के बिना वह कहाँ देखा गया? और तुम्हारे पक्ष में भी आकाश प्रत्यक्ष तो है नहीं।

If you say that space without a world has been seen, where was it seen apart from light and darkness? And on your own view space is surely not perceived.

सद्वस्तु शुद्धन्त्वस्माभिर्निश्चितैरनुभूयते
तूष्णीं स्थितौ न शून्यत्वं शून्यबुद्धेश्च वर्जनात् ॥ ४४ ॥

sadvastu śuddhantvasmābhirniścitairanubhūyate
tūṣṇīṃ sthitau na śūnyatvaṃ śūnyabuddheśca varjanāt || 44 ||

Sadvastu shuddhantvasmaabhirnishchitairanubhuuyate tuushniim sthitau na shuunyatvam shuunyabuddheshcha varjanaat

हम निश्चय कर चुके लोग शुद्ध सत्-वस्तु का अनुभव करते हैं; चुप रह जाने में शून्यता नहीं आती, और शून्य की बुद्धि का भी वर्जन हो जाता है।

We who have settled the matter experience the pure reality; in falling silent there is no voidness, and the very notion of a void is set aside.

सद्बुद्धिरपि चेन्नास्ति मास्त्वस्य स्वप्रभत्वतः
निर्मनस्कत्वसाक्षित्वात्सन्मात्रं सुगमं नृणाम् ॥ ४५ ॥

sadbuddhirapi cennāsti māstvasya svaprabhatvataḥ
nirmanaskatvasākṣitvātsanmātraṃ sugamaṃ nṛṇām || 45 ||

Sadbuddhirapi chennaasti maastvasya svaprabhatvatah nirmanaskatvasaakshitvaatsanmaatram sugamam nrinaam

यदि कहो कि सत् की बुद्धि भी नहीं रहती — तो न रहे, क्योंकि वह स्वयं-प्रकाश है; मन के न रहने पर भी साक्षी बने रहने से मनुष्यों को सन्मात्र सुगम है।

If you say the very notion of being is absent, let it be, for being shines of itself; since it remains the witness even when mind is absent, pure being is easy for men.

मनोजृम्भणराहित्ये यथा साक्षी निराकुलः
मायाजृम्भणतः पूर्वं सत्तथैव निराकुलम् ॥ ४६ ॥

manojṛmbhaṇarāhitye yathā sākṣī nirākulaḥ
māyājṛmbhaṇataḥ pūrvaṃ sattathaiva nirākulam || 46 ||

Manojrimbhanaraahitye yathaa saakshii niraakulah maayaajrimbhanatah puurvam sattathaiva niraakulam

जैसे मन के फैलाव के न रहने पर साक्षी निराकुल रहता है, वैसे ही माया के फैलाव से पहले सत् निराकुल ही था।

As the witness is untroubled when the spreading of the mind is absent, so before the spreading of illusion being was untroubled.

निस्तत्वा कार्यगम्यास्य शक्तिर्मायाऽग्निशक्तिवत्
न हि शक्तिः क्वचित्कैश्चिद्बुध्यते कार्यतः पुरा ॥ ४७ ॥

nistatvā kāryagamyāsya śaktirmāyā'gniśaktivat
na hi śaktiḥ kvacitkaiścidbudhyate kāryataḥ purā || 47 ||

Nistatvaa kaaryagamyaasya shaktirmaayaa'gnishaktivat na hi shaktih kvachitkaishchidbudhyate kaaryatah puraa

इसकी माया-शक्ति निस्तत्त्व है और कार्य से ही जानी जाती है, जैसे अग्नि की शक्ति; कार्य से पहले किसी की शक्ति कहीं किसी के द्वारा नहीं जानी जाती।

Its power of illusion is without substance and is known only from its effect, like the power of fire; before its effect, no one anywhere knows any power.

न सद्वस्तु सतः शक्तिर्नहि वह्नेः स्वशक्तिता
सद्विलक्षणतायां तु शक्तेः किं तत्त्वमुच्यताम्
शून्यत्वमिति चेच्छून्यं मायाकार्यमितीरितम् ॥ ४८ ॥

na sadvastu sataḥ śaktirnahi vahneḥ svaśaktitā
sadvilakṣaṇatāyāṃ tu śakteḥ kiṃ tattvamucyatām
śūnyatvamiti cecchūnyaṃ māyākāryamitīritam || 48 ||

Na sadvastu satah shaktirnahi vahneh svashaktitaa sadvilakshanataayaam tu shakteh kim tattvamuchyataam shuunyatvamiti chechchhuunyam maayaakaaryamitiiritam

शक्ति सत्-वस्तु नहीं है, क्योंकि अग्नि की शक्ति स्वयं अग्नि नहीं होती। तो सत् से विलक्षण होने पर शक्ति का तत्त्व क्या है, बताओ? यदि कहो 'शून्यत्व', तो शून्य तो माया का कार्य कहा जा चुका है।

The power is not the reality, for fire's power is not fire itself. Then, being other than being, what is the nature of the power? If you say voidness, the void has already been called an effect of illusion.

न शून्यं नापि सद्यादृक्तादृक्तत्त्वमिहेष्यताम् ॥ ४९ ॥

na śūnyaṃ nāpi sadyādṛktādṛktattvamiheṣyatām || 49 ||

Na shuunyam naapi sadyaadriktaadriktattvamiheshyataam

अतः वह न शून्य है, न सत्; उसका जैसा-तैसा तत्त्व यहाँ स्वीकार कर लेना चाहिए।

It is therefore neither void nor being; whatever its nature may be, that is what must be granted here.

नासदासीन्नो सदासीत्तदानीं किं त्वभूत्तमः
सद्योगात्तमसः सत्त्वं न स्वतस्तन्निषेधनात् ॥ ५० ॥

nāsadāsīnno sadāsīttadānīṃ kiṃ tvabhūttamaḥ
sadyogāttamasaḥ sattvaṃ na svatastanniṣedhanāt || 50 ||

Naasadaasiinno sadaasiittadaaniim kim tvabhuuttamah sadyogaattamasah sattvam na svatastannishedhanaat

'तब न असत् था, न सत् था; क्या था? तम था' — तम की सत्ता सत् के योग से है, अपने आप से नहीं, क्योंकि उसका निषेध किया गया है।

'Then there was neither non-being nor being; what was there? Darkness was.' The being of that darkness comes from its connection with being, not of itself, since it has been denied.

अत एव द्वितीयत्वं शून्यवन्न हि गण्यते
न लोके चैत्रतच्छक्त्योर्जीवितं लिख्यते पृथक् ॥ ५१ ॥

ata eva dvitīyatvaṃ śūnyavanna hi gaṇyate
na loke caitratacchaktyorjīvitaṃ likhyate pṛthak || 51 ||

Ata eva dvitiiyatvam shuunyavanna hi ganyate na loke chaitratachchhaktyorjiivitam likhyate prithak

इसीलिए, शून्य की तरह, इसकी दूसरी गिनती नहीं की जाती; लोक में भी चैत्र और उसकी शक्ति का जीवन अलग-अलग नहीं लिखा जाता।

For this reason, as with the void, it is not counted as a second; in the world too the life of Caitra and of his power are not written down separately.

शक्त्याधिक्ये जीवितं चेद्वर्धते तत्र वृद्धिकृत्
न शक्तिः किं तु तत्कार्यं युद्धकृष्यादिकं तथा ॥ ५२ ॥

śaktyādhikye jīvitaṃ cedvardhate tatra vṛddhikṛt
na śaktiḥ kiṃ tu tatkāryaṃ yuddhakṛṣyādikaṃ tathā || 52 ||

Shaktyaadhikye jiivitam chedvardhate tatra vriddhikrit na shaktih kim tu tatkaaryam yuddhakrishyaadikam tathaa

यदि कहो कि शक्ति बढ़ने पर जीवन बढ़ता है — तो वहाँ बढ़ाने वाली शक्ति नहीं, बल्कि उसका कार्य है, जैसे युद्ध, खेती आदि।

If you say that when power increases life increases, what increases it there is not the power but its effect — fighting, farming and the like.

सर्वथा शक्तिमात्रस्य न पृथग्गणना क्वचित्
शक्तिकार्यं तु नैवास्ति द्वितीयं शंक्यते कथम् ॥ ५३ ॥

sarvathā śaktimātrasya na pṛthaggaṇanā kvacit
śaktikāryaṃ tu naivāsti dvitīyaṃ śaṃkyate katham || 53 ||

Sarvathaa shaktimaatrasya na prithaggananaa kvachit shaktikaaryam tu naivaasti dvitiiyam shamkyate katham

किसी भी प्रकार शक्ति मात्र की अलग गिनती कहीं नहीं होती; और (सृष्टि से पहले) शक्ति का कार्य तो है ही नहीं — तो दूसरे की शङ्का कैसे की जाए?

In no way is mere power ever counted separately; and the effect of the power does not exist at all, so how can a second be suspected?

न कृत्स्नब्रह्मावृत्तिः सा शक्तिः किन्त्वेकदेशभाक्
घटशक्तिर्यथा भूमौ स्निग्धमृद्येव वर्तते ॥ ५४ ॥

na kṛtsnabrahmāvṛttiḥ sā śaktiḥ kintvekadeśabhāk
ghaṭaśaktiryathā bhūmau snigdhamṛdyeva vartate || 54 ||

Na kritsnabrahmaavrittih saa shaktih kintvekadeshabhaak ghatashaktiryathaa bhuumau snigdhamridyeva vartate

वह शक्ति समस्त ब्रह्म में नहीं रहती, बल्कि उसके एक देश में ही रहती है — जैसे घड़े की शक्ति सारी पृथ्वी में नहीं, चिकनी मिट्टी में ही रहती है।

That power does not pervade the whole of Brahman but belongs to a part of it — as the power to become a pot lies not in all earth but only in clay.

पादोऽस्य सर्वा भूतानि त्रिपादस्ति स्वयंप्रभः
इत्येकदेशवृत्तित्वं मायाया वदति श्रुतिः ॥ ५५ ॥

pādo'sya sarvā bhūtāni tripādasti svayaṃprabhaḥ
ityekadeśavṛttitvaṃ māyāyā vadati śrutiḥ || 55 ||

Paado'sya sarvaa bhuutaani tripaadasti svayamprabhah ityekadeshavrittitvam maayaayaa vadati shrutih

'इसका एक पाद सब भूत हैं, तीन पाद स्वयंप्रकाश हैं' — इस प्रकार श्रुति माया के एकदेश में रहने को कहती है।

'One quarter of him is all beings, three quarters are the self-luminous' — in this way scripture declares that illusion occupies only a part.

विष्टभ्याहमिदं कृत्स्नमेकांशेन स्थितो जगत्
इति कृष्णोऽर्जुनायाह जगतस्त्वेकदेशताम् ॥ ५६ ॥

viṣṭabhyāhamidaṃ kṛtsnamekāṃśena sthito jagat
iti kṛṣṇo'rjunāyāha jagatastvekadeśatām || 56 ||

Vishtabhyaahamidam kritsnamekaamshena sthito jagat iti krishno'rjunaayaaha jagatastvekadeshataam

'मैं इस समस्त जगत् को एक अंश से व्याप्त करके स्थित हूँ' — कृष्ण ने अर्जुन से यह कहकर जगत् का एकदेशपन बताया।

'Pervading this whole world with a single portion I stand' — Kṛṣṇa said this to Arjuna, showing that the world occupies only a part.

स भूमिं विश्वतो वृत्वाऽत्यतिष्ठद्दशांगुलम्
विकारावर्ति चात्रास्ति श्रुतिसूत्रकृतोर्वचः ॥ ५७ ॥

sa bhūmiṃ viśvato vṛtvā'tyatiṣṭhaddaśāṃgulam
vikārāvarti cātrāsti śrutisūtrakṛtorvacaḥ || 57 ||

Sa bhuumim vishvato vritvaa'tyatishthaddashaamgulam vikaaraavarti chaatraasti shrutisuutrakritorvachah

'वह पृथ्वी को सब ओर से घेरकर दस अङ्गुल ऊपर स्थित हुआ' — और 'विकार से परे भी है' — ऐसा श्रुति और सूत्रकार दोनों का वचन है।

'He covered the earth on every side and stood ten fingers beyond' — and 'there is that which lies beyond change' — so say both scripture and the author of the aphorisms.

निरंशेऽप्यंशमारोप्य कृत्स्नेंऽशे वेति पृच्छतः
तद्भाषयोत्तरं ब्रूते श्रुतिः श्रोतृहितैषिणी ॥ ५८ ॥

niraṃśe'pyaṃśamāropya kṛtsneṃ'śe veti pṛcchataḥ
tadbhāṣayottaraṃ brūte śrutiḥ śrotṛhitaiṣiṇī || 58 ||

Niramshe'pyamshamaaropya kritsnem'she veti prichchhatah tadbhaashayottaram bruute shrutih shrotrihitaishinii

निरंश में भी अंश का आरोप करके जो पूछता है 'क्या सम्पूर्ण में या एक अंश में?' — श्रोता के हित की इच्छा से श्रुति उसी की भाषा में उत्तर देती है।

To one who, imposing parts on the partless, asks 'in the whole or in a part?', scripture, wishing the hearer's good, answers in his own language.

सत्तत्त्वमाश्रिता शक्तिः कल्पयेत्सति विक्रियाः
वर्णा भित्तिगता भित्तौ चित्रं नानाविधं तथा ॥ ५९ ॥

sattattvamāśritā śaktiḥ kalpayetsati vikriyāḥ
varṇā bhittigatā bhittau citraṃ nānāvidhaṃ tathā || 59 ||

Sattattvamaashritaa shaktih kalpayetsati vikriyaah varnaa bhittigataa bhittau chitram naanaavidham tathaa

सत्-तत्त्व के आश्रय में रहकर शक्ति सत् में विकारों की कल्पना करती है — जैसे भित्ति पर चढ़े रंग भित्ति में नाना प्रकार का चित्र बना देते हैं।

Resting on the reality, the power imagines changes in it — as colours laid on a wall make many kinds of picture on the wall.

आद्यो विकार आकाशः सोऽवकाशस्वरूपवान्
आकाशोऽस्तीति सत्त्वमाकाशेऽप्यनुगच्छति ॥ ६० ॥

ādyo vikāra ākāśaḥ so'vakāśasvarūpavān
ākāśo'stīti sattvamākāśe'pyanugacchati || 60 ||

Aadyo vikaara aakaashah so'vakaashasvaruupavaan aakaasho'stiiti sattvamaakaashe'pyanugachchhati

पहला विकार आकाश है, जिसका स्वरूप अवकाश देना है; 'आकाश है' — इस प्रकार सत्ता आकाश में भी अनुगत रहती है।

The first change is space, whose nature is to give room; in the words 'space is', being runs on into space as well.

एकस्वभावं सत्तत्वमाकाशो द्विस्वभावकः
नावकाशः सति व्योम्नि स चैषोऽपि द्वयं स्थितम् ॥ ६१ ॥

ekasvabhāvaṃ sattatvamākāśo dvisvabhāvakaḥ
nāvakāśaḥ sati vyomni sa caiṣo'pi dvayaṃ sthitam || 61 ||

Ekasvabhaavam sattatvamaakaasho dvisvabhaavakah naavakaashah sati vyomni sa chaisho'pi dvayam sthitam

सत्-तत्त्व का एक ही स्वभाव है, आकाश के दो स्वभाव हैं; सत् में अवकाश नहीं है, पर आकाश में वह (अवकाश) और यह (सत्ता) — दोनों रहते हैं।

The reality has one nature, space has two; there is no room-giving in being, but in space both that and this — room-giving and being — are present.

यद्वा प्रतिध्वनिर्व्योम्नो गुणो नासौ सतीक्ष्यते
व्योम्नि द्वौ सद्ध्वनी तेन सदेकं द्विगुणं वियत् ॥ ६२ ॥

yadvā pratidhvanirvyomno guṇo nāsau satīkṣyate
vyomni dvau saddhvanī tena sadekaṃ dviguṇaṃ viyat || 62 ||

Yadvaa pratidhvanirvyomno guno naasau satiikshyate vyomni dvau saddhvanii tena sadekam dvigunam viyat

अथवा, प्रतिध्वनि आकाश का गुण है, और वह सत् में नहीं देखा जाता; इस प्रकार आकाश में सत्ता और ध्वनि — दो हैं। इसलिए सत् एक गुण वाला है और आकाश दो गुण वाला।

Or again, the echo is a quality of space and is not seen in being; so in space there are two, being and sound. Being therefore has one quality and space two.

या शक्तिः कल्पयेद्व्योम सा सद्व्योम्नोरभिन्नताम्
आपाद्य धर्मधर्मित्वं व्युत्ययेनावकल्पयेत् ॥ ६३ ॥

yā śaktiḥ kalpayedvyoma sā sadvyomnorabhinnatām
āpādya dharmadharmitvaṃ vyutyayenāvakalpayet || 63 ||

Yaa shaktih kalpayedvyoma saa sadvyomnorabhinnataam aapaadya dharmadharmitvam vyutyayenaavakalpayet

जो शक्ति आकाश की कल्पना करती है, वही सत् और आकाश में अभिन्नता लाकर धर्म-धर्मी-भाव को उलटकर कल्पित कर देती है।

The same power that imagines space brings being and space to seem one, and then imagines the relation of quality and possessor the other way about.

सतो व्योमत्वमापन्नं व्योम्नः सत्तां तु लौकिकाः
तार्किकाश्चावगच्छन्ति मायाया उचितं हि तत् ॥ ६४ ॥

sato vyomatvamāpannaṃ vyomnaḥ sattāṃ tu laukikāḥ
tārkikāścāvagacchanti māyāyā ucitaṃ hi tat || 64 ||

Sato vyomatvamaapannam vyomnah sattaam tu laukikaah taarkikaashchaavagachchhanti maayaayaa uchitam hi tat

लौकिक लोग और तार्किक सत् को आकाश-रूप हुआ और आकाश को सत्तावाला समझते हैं; माया के लिए यही उचित है।

Worldly men and logicians take being to have become space, and space to possess being; and that is just what suits illusion.

यद्यथा वर्तते तस्य तथात्वं भाति मानतः
अन्यथात्वं भ्रमेणेति न्यायोऽयं सार्वलौकिकः ॥ ६५ ॥

yadyathā vartate tasya tathātvaṃ bhāti mānataḥ
anyathātvaṃ bhrameṇeti nyāyo'yaṃ sārvalaukikaḥ || 65 ||

Yadyathaa vartate tasya tathaatvam bhaati maanatah anyathaatvam bhrameneti nyaayo'yam saarvalaukikah

जो वस्तु जैसी है, प्रमाण से उसका वैसा ही भान होता है; और उससे अन्यथा भान भ्रम से होता है — यह न्याय सब जगह माना हुआ है।

A thing shines as it is when a means of knowledge shows it, and otherwise than it is through error — this rule holds everywhere.

एवं श्रुतिविचारात् प्राग्यथा यद्वस्तु भासते
विचारेण विपर्येति ततस्तच्चिन्त्यतां वियत् ॥ ६६ ॥

evaṃ śrutivicārāt prāgyathā yadvastu bhāsate
vicāreṇa viparyeti tatastaccintyatāṃ viyat || 66 ||

Evam shrutivichaaraat praagyathaa yadvastu bhaasate vichaarena viparyeti tatastachchintyataam viyat

इसी प्रकार श्रुति के विचार से पहले जो वस्तु जैसी भासती है, विचार से वह उलट जाती है; इसलिए आकाश के विषय में यही सोचना चाहिए।

So too, what shines in one way before scripture is examined turns out otherwise upon examination; space should therefore be thought of in this way.

भिन्ने वियत्सती शब्दभेदाद्बुद्धेश्च भेदतः
वाय्वादिष्वनुवृत्तं सन्नतु व्योमेति भेदधीः ॥ ६७ ॥

bhinne viyatsatī śabdabhedādbuddheśca bhedataḥ
vāyvādiṣvanuvṛttaṃ sannatu vyometi bhedadhīḥ || 67 ||

Bhinne viyatsatii shabdabhedaadbuddheshcha bhedatah vaayvaadishvanuvrittam sannatu vyometi bhedadhiih

आकाश और सत् भिन्न हैं, क्योंकि उनके शब्द भिन्न हैं और उनकी बुद्धि भी भिन्न है; वायु आदि में सत् अनुगत है पर आकाश नहीं — यही भेद की बुद्धि है।

Space and being are different, for their words differ and the notions of them differ; being runs on into air and the rest but space does not — such is the notion of their difference.

सद्वस्त्वधिकवृत्तित्वाद्धर्मि व्योम्नस्तु धर्मता
धिया सतः पृथक्कारे ब्रूहि व्योम किमात्मकं ॥ ६८ ॥

sadvastvadhikavṛttitvāddharmi vyomnastu dharmatā
dhiyā sataḥ pṛthakkāre brūhi vyoma kimātmakaṃ || 68 ||

Sadvastvadhikavrittitvaaddharmi vyomnastu dharmataa dhiyaa satah prithakkaare bruuhi vyoma kimaatmakam

सत्-वस्तु अधिक व्यापक होने से धर्मी है और आकाश उसका धर्म है। बुद्धि से सत् को अलग कर देने पर बताओ, आकाश किस स्वरूप का रह जाता है?

Being, since it extends further, is the possessor, and space is its quality. Set being aside in thought and tell us what nature space is then left with.

अवकाशात्मकं तच्चेदसत्तदिति चिन्त्यताम्
भिन्नं सतोऽसच्च नेति वक्षि चेद् व्याहृतिस्तव ॥ ६९ ॥

avakāśātmakaṃ taccedasattaditi cintyatām
bhinnaṃ sato'sacca neti vakṣi ced vyāhṛtistava || 69 ||

Avakaashaatmakam tachchedasattaditi chintyataam bhinnam sato'sachcha neti vakshi ched vyaahritistava

यदि कहो कि वह अवकाश-रूप है, तो सोचो कि वह असत् ही है; और यदि कहो कि वह सत् से भिन्न भी है और असत् भी नहीं, तो तुम्हारा कथन ही परस्पर-विरुद्ध है।

If you say it is room-giving in nature, then consider that it is unreal; and if you say it is other than being and yet not unreal, your own statement contradicts itself.

भातीति चेद्भातु नाम भूषणं मायिकस्य तत्
यदसद्भासमानं तन्मिथ्या स्वप्नगजादिवत् ॥ ७० ॥

bhātīti cedbhātu nāma bhūṣaṇaṃ māyikasya tat
yadasadbhāsamānaṃ tanmithyā svapnagajādivat || 70 ||

Bhaatiiti chedbhaatu naama bhuushanam maayikasya tat yadasadbhaasamaanam tanmithyaa svapnagajaadivat

यदि कहो 'वह भासता तो है' — तो भासे; यह तो मायिक वस्तु का ही भूषण है। जो असत् होकर भासता है वह मिथ्या है, स्वप्न के हाथी आदि की तरह।

If you say 'yet it shines', let it shine; that is the very ornament of what belongs to illusion. What is unreal and yet shines is false, like the elephant of a dream.

जातिव्यक्ती देहिदेहौ गुणद्रव्ये यथा पृथक्
वियत्सतोस्तथैवास्तु पार्थक्यं कोऽत्र विस्मयः ॥ ७१ ॥

jātivyaktī dehidehau guṇadravye yathā pṛthak
viyatsatostathaivāstu pārthakyaṃ ko'tra vismayaḥ || 71 ||

Jaativyaktii dehidehau gunadravye yathaa prithak viyatsatostathaivaastu paarthakyam ko'tra vismayah

जैसे जाति और व्यक्ति, देही और देह, गुण और द्रव्य अलग-अलग हैं, वैसे ही आकाश और सत् का पार्थक्य भी हो — इसमें आश्चर्य क्या है?

As class and individual, the embodied and the body, quality and substance are distinct, let space and being be distinct in the same way; what is there to wonder at?

बुद्धोऽपि भेदो नो चित्ते निरूढिं याति चेत्तदा
अनैकाग्र्यात्संशयाद्वा रूढ्यभावोऽस्य ते वद ॥ ७२ ॥

buddho'pi bhedo no citte nirūḍhiṃ yāti cettadā
anaikāgryātsaṃśayādvā rūḍhyabhāvo'sya te vada || 72 ||

Buddho'pi bhedo no chitte niruudhim yaati chettadaa anaikaagryaatsamshayaadvaa ruudhyabhaavo'sya te vada

यदि भेद समझ में आने पर भी चित्त में दृढ़ न हो, तो बताओ — यह अनेकाग्रता से है या संशय से?

If the difference, though understood, does not take firm hold in the mind, then say whether this comes from want of concentration or from doubt.

अप्रमत्तो भव ध्यानादाद्येऽन्यस्मिन् विवेचनम्
कुरु प्रमाणयुक्तिभ्यां ततो रूढतमो भवेत् ॥ ७३ ॥

apramatto bhava dhyānādādye'nyasmin vivecanam
kuru pramāṇayuktibhyāṃ tato rūḍhatamo bhavet || 73 ||

Apramatto bhava dhyaanaadaadye'nyasmin vivechanam kuru pramaanayuktibhyaam tato ruudhatamo bhavet

पहले (अनेकाग्रता) में ध्यान के द्वारा सावधान हो; दूसरे (संशय) में प्रमाण और युक्ति से विवेचन कर; तब वह भेद अत्यन्त दृढ़ हो जाएगा।

In the first case be watchful through meditation; in the second, sift the matter by scripture and reasoning; then that difference will become most firm.

ध्यानान्मानाद्युक्तितोऽपि रूढे भेदे वियत्सतोः
न कदाचिद्वियत्सत्यं सद्वस्तु च्छिद्रवन्न च ॥ ७४ ॥

dhyānānmānādyuktito'pi rūḍhe bhede viyatsatoḥ
na kadācidviyatsatyaṃ sadvastu cchidravanna ca || 74 ||

Dhyaanaanmaanaadyuktito'pi ruudhe bhede viyatsatoh na kadaachidviyatsatyam sadvastu chchhidravanna cha

ध्यान से, प्रमाण से और युक्ति से आकाश और सत् का भेद दृढ़ हो जाने पर, आकाश कभी सत्य नहीं लगता और सत्-वस्तु छिद्र वाली नहीं लगती।

When by meditation, by scripture and by reasoning the difference between space and being has become firm, space never seems real, nor does the reality seem to have a hollow in it.

ज्ञस्य सदा भाति व्योम निस्तत्त्वोल्लेखपूर्ववत्
सद्वस्त्वपि विभात्यस्य निश्छिद्रत्वपुरस्सरम् ॥ ७५ ॥

jñasya sadā bhāti vyoma nistattvollekhapūrvavat
sadvastvapi vibhātyasya niśchidratvapurassaram || 75 ||

Jnasya sadaa bhaati vyoma nistattvollekhapuurvavat sadvastvapi vibhaatyasya nishchhidratvapurassaram

ज्ञानी को आकाश सदा वैसा ही भासता है जैसे पहले से तत्त्वहीन कहा गया हो; और सत्-वस्तु भी उसे छिद्र-रहित रूप में ही भासती है।

To the knower space always shines as something already marked down as without substance, and the reality shines to him as without any hollow in it.

वासनायां प्रवृद्धायां वियत्सत्यत्ववादिनम्
सन्मात्राबोधयुक्तं च दृष्ट्वा विस्मयते बुधः ॥ ७६ ॥

vāsanāyāṃ pravṛddhāyāṃ viyatsatyatvavādinam
sanmātrābodhayuktaṃ ca dṛṣṭvā vismayate budhaḥ || 76 ||

Vaasanaayaam pravriddhaayaam viyatsatyatvavaadinam sanmaatraabodhayuktam cha drishtvaa vismayate budhah

वासना के दृढ़ हो जाने पर, आकाश को सत्य कहने वाले और सन्मात्र के बोध से रहित मनुष्य को देखकर ज्ञानी आश्चर्य करता है।

When that habit has grown strong, the wise man is astonished to see one who calls space real and is without the knowledge of pure being.

एवमाकाशमिथ्यात्वे सत्सत्यत्वे च वासिते
न्यायेनानेन वाय्वादेः सद्वस्तु प्रविविच्यताम् ॥ ७७ ॥

evamākāśamithyātve satsatyatve ca vāsite
nyāyenānena vāyvādeḥ sadvastu pravivicyatām || 77 ||

Evamaakaashamithyaatve satsatyatve cha vaasite nyaayenaanena vaayvaadeh sadvastu pravivichyataam

इस प्रकार आकाश का मिथ्यात्व और सत् का सत्यत्व मन में बैठ जाने पर, इसी न्याय से वायु आदि से भी सत्-वस्तु का विवेचन करना चाहिए।

When in this way the falsity of space and the reality of being have settled in the mind, the reality should be sifted out from air and the rest by the same rule.

सद्वस्तुन्येकदेशस्या माया तत्त्रैकदेशगम्
वियत्तत्राप्येकदेशगतो वायुः प्रकल्पितः ॥ ७८ ॥

sadvastunyekadeśasyā māyā tattraikadeśagam
viyattatrāpyekadeśagato vāyuḥ prakalpitaḥ || 78 ||

Sadvastunyekadeshasyaa maayaa tattraikadeshagam viyattatraapyekadeshagato vaayuh prakalpitah

सत्-वस्तु के एक देश में माया है; उस माया के एक देश में आकाश है; और उस आकाश के भी एक देश में वायु कल्पित है।

In one part of the reality is illusion; in one part of that illusion is space; and in one part of that space again air is imagined.

शोषस्पर्शौ गतिर्वेगः वायुधर्मा इमे मताः
त्रयः स्वभावाः सन्मायाव्योम्नां ये तेऽपि वायुगाः ॥ ७९ ॥

śoṣasparśau gatirvegaḥ vāyudharmā ime matāḥ
trayaḥ svabhāvāḥ sanmāyāvyomnāṃ ye te'pi vāyugāḥ || 79 ||

Shoshasparshau gatirvegah vaayudharmaa ime mataah trayah svabhaavaah sanmaayaavyomnaam ye te'pi vaayugaah

शोषण, स्पर्श, गति और वेग — ये वायु के धर्म माने जाते हैं; और सत्, माया तथा आकाश के जो तीन स्वभाव हैं वे भी वायु में हैं।

Drying, touch, motion and speed are held to be the properties of air; and the three natures that belong to being, illusion and space are present in air as well.

वायुरस्तीति सद्भावः सतो वायौ पृथक्कृते
निस्तत्वरूपता मायास्वभावो व्योमगो ध्वनिः ॥ ८० ॥

vāyurastīti sadbhāvaḥ sato vāyau pṛthakkṛte
nistatvarūpatā māyāsvabhāvo vyomago dhvaniḥ || 80 ||

Vaayurastiiti sadbhaavah sato vaayau prithakkrite nistatvaruupataa maayaasvabhaavo vyomago dhvanih

'वायु है' — यह सत्ता है; सत् को अलग कर देने पर जो निस्तत्त्वरूपता बचती है वह माया का स्वभाव है, और ध्वनि आकाश का।

'Air is' — that is being. When being is set aside, the substancelessness that remains is the nature of illusion, and sound is what belongs to space.

सतोऽनुवृत्तिः सर्वत्र व्योम्नो नेति पुरेरितम्
व्योमानुवृत्तिरधुना कथं न व्याहतं वचः ॥ ८१ ॥

sato'nuvṛttiḥ sarvatra vyomno neti pureritam
vyomānuvṛttiradhunā kathaṃ na vyāhataṃ vacaḥ || 81 ||

Sato'nuvrittih sarvatra vyomno neti pureritam vyomaanuvrittiradhunaa katham na vyaahatam vachah

शङ्का: पहले कहा गया था कि सत् की अनुवृत्ति सर्वत्र है, आकाश की नहीं; अब आकाश की अनुवृत्ति कही — यह वचन परस्पर-विरुद्ध कैसे नहीं?

An objection: it was said before that being runs on everywhere but space does not; now space is said to run on. How is this statement not self-contradictory?

छिद्रानुवृत्तिर्नेतीति पूर्वोक्तिरधुना त्वियम्
शब्दानुवृत्तिरेवोक्ता वचसो व्याहतिः कुतः ॥ ८२ ॥

chidrānuvṛttirnetīti pūrvoktiradhunā tviyam
śabdānuvṛttirevoktā vacaso vyāhatiḥ kutaḥ || 82 ||

Chhidraanuvrittirnetiiti puurvoktiradhunaa tviyam shabdaanuvrittirevoktaa vachaso vyaahatih kutah

उत्तर: पहले 'छिद्र की अनुवृत्ति नहीं' कहा गया था; अब शब्द की अनुवृत्ति ही कही गई है। तो वचन का विरोध कहाँ से?

The answer: what was said before was that the hollow does not run on; what is said now is that sound runs on. Whence then the contradiction?

ननु सद्वस्तुपार्थक्यादसत्त्वं चेत्तदा कथम्
अव्यक्तमायावैषम्यादमायामयताऽपि नो ॥ ८३ ॥

nanu sadvastupārthakyādasattvaṃ cettadā katham
avyaktamāyāvaiṣamyādamāyāmayatā'pi no || 83 ||

Nanu sadvastupaarthakyaadasattvam chettadaa katham avyaktamaayaavaishamyaadamaayaamayataa'pi no

शङ्का: यदि सत्-वस्तु से पृथक् होने के कारण असत्त्व है, तो फिर अव्यक्त माया की विषमता के कारण उसका अमायामय होना भी कैसे नहीं?

An objection: if unreality follows from being distinct from the reality, then, because of the unevenness of unmanifest illusion, why does it not follow that it is not made of illusion either?

निस्तत्त्वरूपतैवात्र मायात्वस्य प्रयोजिका
सा शक्तिकार्ययोस्तुल्या व्यक्ताव्यक्तत्वभेदिनोः ॥ ८४ ॥

nistattvarūpataivātra māyātvasya prayojikā
sā śaktikāryayostulyā vyaktāvyaktatvabhedinoḥ || 84 ||

Nistattvaruupataivaatra maayaatvasya prayojikaa saa shaktikaaryayostulyaa vyaktaavyaktatvabhedinoh

उत्तर: यहाँ मायापन का प्रयोजक निस्तत्त्वरूपता ही है; और वह शक्ति तथा उसके कार्य — दोनों में समान है, चाहे वे व्यक्त और अव्यक्त से भिन्न हों।

The answer: here it is substancelessness alone that makes a thing illusion; and that is the same in the power and in its effect, though they differ as unmanifest and manifest.

सदसत्वविवेकस्य प्रस्तुतत्वात्स चिन्त्यताम्
असतोऽवान्तरभेद आस्तां तच्चिन्तयात्र किम् ॥ ८५ ॥

sadasatvavivekasya prastutatvātsa cintyatām
asato'vāntarabheda āstāṃ taccintayātra kim || 85 ||

Sadasatvavivekasya prastutatvaatsa chintyataam asato'vaantarabheda aastaam tachchintayaatra kim

सत् और असत् का विवेक ही प्रस्तुत है, अतः उसी का विचार करना चाहिए; असत् के भीतर के भेद भले रहें, उनका विचार यहाँ किसलिए?

What is before us is the discernment of the real and the unreal, and that is what should be thought about; let the inner divisions of the unreal stand — what have we to do with them here?

सद्वस्तु ब्रह्म शिष्टोंशो वायुर्मिथ्या यथा वियत्
वासयित्वा चिरं वायोर्मिथ्यात्वं मरुतं त्यजेत् ॥ ८६ ॥

sadvastu brahma śiṣṭoṃśo vāyurmithyā yathā viyat
vāsayitvā ciraṃ vāyormithyātvaṃ marutaṃ tyajet || 86 ||

Sadvastu brahma shishtomsho vaayurmithyaa yathaa viyat vaasayitvaa chiram vaayormithyaatvam marutam tyajet

सत्-वस्तु ब्रह्म है, बचा हुआ अंश वायु है, और वह आकाश की तरह मिथ्या है; वायु के मिथ्यात्व को चिरकाल तक मन में बसाकर वायु को छोड़ देना चाहिए।

The reality is Brahman; the portion that is left over is air, and it is false as space is. Having long settled the falsity of air in the mind, one should let air go.

चिन्तयेद्वह्निमप्येवं मरुतो न्यूनवर्तिनम्
ब्रह्माण्डावरणेष्वेषां न्यूनाधिकविचारणा ॥ ८७ ॥

cintayedvahnimapyevaṃ maruto nyūnavartinam
brahmāṇḍāvaraṇeṣveṣāṃ nyūnādhikavicāraṇā || 87 ||

Chintayedvahnimapyevam maruto nyuunavartinam brahmaandaavaraneshveshaam nyuunaadhikavichaaranaa

इसी प्रकार वायु से कम विस्तार वाली अग्नि का भी विचार करे; ब्रह्माण्ड के आवरणों में इनके कम-अधिक होने का विचार किया गया है।

In the same way one should consider fire, which occupies less than air; the greater and lesser extent of these is worked out in the coverings of the world-egg.

वायोर्दशांशतो न्यूनो वह्निर्वायौ प्रकल्पितः
पुराणोक्तं तारतम्यं दशांशैर्भूतपञ्चके ॥ ८८ ॥

vāyordaśāṃśato nyūno vahnirvāyau prakalpitaḥ
purāṇoktaṃ tāratamyaṃ daśāṃśairbhūtapañcake || 88 ||

Vaayordashaamshato nyuuno vahnirvaayau prakalpitah puraanoktam taaratamyam dashaamshairbhuutapanchake

वायु से दसवें भाग कम अग्नि वायु में कल्पित है; पुराणों में पाँच भूतों का यही दशांश-क्रम से तारतम्य कहा गया है।

Fire, a tenth less than air, is imagined in air; the ancient lore states this gradation of the five elements by tenths.

वह्निरुष्णः प्रकाशात्मा पूर्वानुगतिरत्र च
अस्ति वह्निः स निस्तत्वः शब्दवान् स्पर्शवानपि ॥ ८९ ॥

vahniruṣṇaḥ prakāśātmā pūrvānugatiratra ca
asti vahniḥ sa nistatvaḥ śabdavān sparśavānapi || 89 ||

Vahnirushnah prakaashaatmaa puurvaanugatiratra cha asti vahnih sa nistatvah shabdavaan sparshavaanapi

अग्नि उष्ण और प्रकाशस्वरूप है, और उसमें पहले वालों की अनुवृत्ति भी है — 'अग्नि है' यह सत्ता, निस्तत्त्वता, शब्द और स्पर्श भी उसमें हैं।

Fire is hot and is light by nature, and in it the earlier elements also run on — 'fire is', its substancelessness, its sound, and its touch as well.

सन्मायाव्योमवाय्वंशैर्युक्तस्याग्नेर्निजो गुणः
रूपं तत्र सतः सर्वमन्यद्बुद्ध्या विविच्यताम् ॥ ९० ॥

sanmāyāvyomavāyvaṃśairyuktasyāgnernijo guṇaḥ
rūpaṃ tatra sataḥ sarvamanyadbuddhyā vivicyatām || 90 ||

Sanmaayaavyomavaayvamshairyuktasyaagnernijo gunah ruupam tatra satah sarvamanyadbuddhyaa vivichyataam

सत्, माया, आकाश और वायु के अंशों से युक्त अग्नि का अपना गुण रूप है; वहाँ सत् को और शेष सबको बुद्धि से अलग-अलग कर लेना चाहिए।

Fire, joined with portions of being, illusion, space and air, has form as its own quality; there one should separate out being from all the rest by the understanding.

सतो विवेचिते वह्नौ मिथ्यात्वे सति वासिते
आपो दशांशतो न्यूनाः कल्पिता इति चिन्तयेत् ॥ ९१ ॥

sato vivecite vahnau mithyātve sati vāsite
āpo daśāṃśato nyūnāḥ kalpitā iti cintayet || 91 ||

Sato vivechite vahnau mithyaatve sati vaasite aapo dashaamshato nyuunaah kalpitaa iti chintayet

अग्नि से सत् को विवेचित कर लेने और उसके मिथ्यात्व को मन में बसा लेने पर, दसवें भाग कम जल कल्पित है — ऐसा विचार करे।

When being has been sifted out of fire and its falsity has been settled in the mind, one should consider that water, a tenth less, is imagined in it.

सन्त्यापोऽमूः शून्यतत्त्वाः सशब्दस्पर्शसंयुताः
रूपवत्योऽन्यधर्मानुवृत्त्या स्वीयो रसो गुणः ॥ ९२ ॥

santyāpo'mūḥ śūnyatattvāḥ saśabdasparśasaṃyutāḥ
rūpavatyo'nyadharmānuvṛttyā svīyo raso guṇaḥ || 92 ||

Santyaapo'muuh shuunyatattvaah sashabdasparshasamyutaah ruupavatyo'nyadharmaanuvrittyaa sviiyo raso gunah

ये जल हैं, तत्त्व से शून्य, शब्द और स्पर्श से युक्त, दूसरों के धर्मों की अनुवृत्ति से रूपवाले भी; और इनका अपना गुण रस है।

These waters are, without substance, joined with sound and touch, and having form too by the running on of others' properties; their own quality is taste.

सतो विवेचितास्वप्सु तन्मिथ्यात्वेन वासिते
भूमिर्दशांशतो न्यूना कल्पिताप्स्विति चिन्तयेत् ॥ ९३ ॥

sato vivecitāsvapsu tanmithyātvena vāsite
bhūmirdaśāṃśato nyūnā kalpitāpsviti cintayet || 93 ||

Sato vivechitaasvapsu tanmithyaatvena vaasite bhuumirdashaamshato nyuunaa kalpitaapsviti chintayet

जल से सत् को विवेचित कर लेने और उसके मिथ्यात्व को मन में बसा लेने पर, दसवें भाग कम पृथ्वी जल में कल्पित है — ऐसा विचार करे।

When being has been sifted out of the waters and their falsity has been settled in the mind, one should consider that earth, a tenth less, is imagined in them.

अस्ति भूस्तत्त्वशून्याऽस्यां शब्दस्पर्शौ सरूपकौ
रसश्च परतो गन्धो नैजः सत्ता विविच्यताम् ॥ ९४ ॥

asti bhūstattvaśūnyā'syāṃ śabdasparśau sarūpakau
rasaśca parato gandho naijaḥ sattā vivicyatām || 94 ||

Asti bhuustattvashuunyaa'syaam shabdasparshau saruupakau rasashcha parato gandho naijah sattaa vivichyataam

पृथ्वी है, तत्त्व से शून्य है; इसमें शब्द, स्पर्श, रूप और रस दूसरों से आए हैं, अपना गुण गन्ध है; सत्ता को इनसे अलग कर लेना चाहिए।

Earth is, and is without substance; in it sound, touch, form and taste come from others, and smell is its own quality; being should be sifted out from these.

पृथक्कृतायां सत्तायां भूमिर्मिथ्याऽवशिष्यते
भूमेर्दशांशतो न्यूनं ब्रह्माण्डं भूमिमध्यगम् ॥ ९५ ॥

pṛthakkṛtāyāṃ sattāyāṃ bhūmirmithyā'vaśiṣyate
bhūmerdaśāṃśato nyūnaṃ brahmāṇḍaṃ bhūmimadhyagam || 95 ||

Prithakkritaayaam sattaayaam bhuumirmithyaa'vashishyate bhuumerdashaamshato nyuunam brahmaandam bhuumimadhyagam

सत्ता को अलग कर देने पर पृथ्वी मिथ्या ही शेष रहती है। पृथ्वी से दसवें भाग कम ब्रह्माण्ड पृथ्वी के मध्य में है।

When being is set apart, earth remains as merely false. The world-egg, a tenth less than earth, lies within the earth.

ब्रह्माण्डमध्ये तिष्ठन्ति भुवनानि चतुर्दश
भुवनेषु वसन्त्येषु प्राणिदेहा यथायथम् ॥ ९६ ॥

brahmāṇḍamadhye tiṣṭhanti bhuvanāni caturdaśa
bhuvaneṣu vasantyeṣu prāṇidehā yathāyatham || 96 ||

Brahmaandamadhye tishthanti bhuvanaani chaturdasha bhuvaneshu vasantyeshu praanidehaa yathaayatham

ब्रह्माण्ड के भीतर चौदह भुवन ठहरे हुए हैं; और इन भुवनों में प्राणियों के शरीर यथायोग्य बसते हैं।

Within the world-egg stand the fourteen worlds; and in those worlds the bodies of living beings dwell, each as is fitting.

ब्रह्माण्डलोकदेहेषु सद्वस्तुनि पृथक्कृते
असंतोऽण्डादयो भान्तु तद्भानेऽपीह का क्षतिः ॥ ९७ ॥

brahmāṇḍalokadeheṣu sadvastuni pṛthakkṛte
asaṃto'ṇḍādayo bhāntu tadbhāne'pīha kā kṣatiḥ || 97 ||

Brahmaandalokadeheshu sadvastuni prithakkrite asamto'ndaadayo bhaantu tadbhaane'piiha kaa kshatih

ब्रह्माण्ड, लोक और देहों में से सत्-वस्तु को अलग कर देने पर, असत् अण्ड आदि भले भासते रहें; उनके भासने में यहाँ हानि क्या है?

When the reality has been set apart from the world-egg, the worlds and the bodies, let the unreal egg and the rest shine on; what harm is there in their shining?

भूतभौतिकमायानामसत्वेऽत्यन्तवासिते
सद्वस्त्वद्वैतमित्येषा धीर्विपर्येति न क्वचित् ॥ ९८ ॥

bhūtabhautikamāyānāmasatve'tyantavāsite
sadvastvadvaitamityeṣā dhīrviparyeti na kvacit || 98 ||

Bhuutabhautikamaayaanaamasatve'tyantavaasite sadvastvadvaitamityeshaa dhiirviparyeti na kvachit

भूत, भौतिक और माया के असत्त्व के अत्यन्त दृढ़ हो जाने पर, 'सत्-वस्तु अद्वैत है' — यह बुद्धि कहीं भी उलटती नहीं।

When the unreality of the elements, of what is made of them, and of illusion has grown quite firm, the conviction 'the reality is without a second' is nowhere overturned.

सदद्वैतात् पृथग्भूते द्वैते भूम्यादिरूपिणि
तत्तदर्थक्रिया लोके यथा दृष्टा तथैव सा ॥ ९९ ॥

sadadvaitāt pṛthagbhūte dvaite bhūmyādirūpiṇi
tattadarthakriyā loke yathā dṛṣṭā tathaiva sā || 99 ||

Sadadvaitaat prithagbhuute dvaite bhuumyaadiruupini tattadarthakriyaa loke yathaa drishtaa tathaiva saa

सत् अद्वैत से पृथक् हुए, पृथ्वी आदि रूप वाले द्वैत में, उन-उन वस्तुओं की अर्थक्रिया लोक में जैसी देखी जाती है, वैसी ही रहती है।

In duality, set apart from the reality without a second and taking the form of earth and the rest, each thing's working goes on just as it is seen to go on in the world.

साङ्ख्यकाणादबौद्धाद्यैर्जगद्भेदो यथा यथा
उत्प्रेक्ष्यतेऽनेकयुक्त्या भवत्वेष तथा तथा ॥ १०० ॥

sāṅkhyakāṇādabauddhādyairjagadbhedo yathā yathā
utprekṣyate'nekayuktyā bhavatveṣa tathā tathā || 100 ||

Saankhyakaanaadabauddhaadyairjagadbhedo yathaa yathaa utprekshyate'nekayuktyaa bhavatvesha tathaa tathaa

साङ्ख्य, काणाद, बौद्ध आदि जो अनेक युक्तियों से जगत् के भेद की जैसी-जैसी कल्पना करते हैं, वह वैसी-वैसी ही हो — कोई हानि नहीं।

However the Sāṅkhyas, the followers of Kaṇāda, the Buddhists and the rest may imagine the divisions of the world by their many arguments, let it be just so.

अवज्ञातं सदद्वैतं निश्शंकैरन्यवादिभिः
एवं का क्षतिरस्माकं तद्द्वैतमवजानताम् ॥ १०१ ॥

avajñātaṃ sadadvaitaṃ niśśaṃkairanyavādibhiḥ
evaṃ kā kṣatirasmākaṃ taddvaitamavajānatām || 101 ||

Avajnaatam sadadvaitam nishshamkairanyavaadibhih evam kaa kshatirasmaakam taddvaitamavajaanataam

निःशङ्क होकर दूसरे वादियों ने सत् अद्वैत का अनादर किया; इसी तरह हम उनके द्वैत का अनादर करें तो हमारी क्या हानि?

Other disputants have without hesitation slighted the reality without a second; what loss is it to us if we in the same way slight their duality?

द्वैतावज्ञा सुस्थिता चेदद्वैते धीः स्थिरा भवेत्
स्थैर्ये तस्याः पुमानेष जीवन्मुक्त इतीर्यते ॥ १०२ ॥

dvaitāvajñā susthitā cedadvaite dhīḥ sthirā bhavet
sthairye tasyāḥ pumāneṣa jīvanmukta itīryate || 102 ||

Dvaitaavajnaa susthitaa chedadvaite dhiih sthiraa bhavet sthairye tasyaah pumaanesha jiivanmukta itiiryate

यदि द्वैत का अनादर भलीभाँति स्थिर हो जाए तो अद्वैत में बुद्धि स्थिर हो जाती है; उसी स्थिरता से यह पुरुष जीवन्मुक्त कहा जाता है।

If the slighting of duality stands firm, the understanding becomes steady in non-duality; by that steadiness this man is called free while living.

एषा ब्राह्मी स्थितिः पार्थ नैनां प्राप्य विमुह्यति
स्थित्वाऽस्यामन्तकालेऽपि ब्रह्मनिर्वाणमृच्छति ॥ १०३ ॥

eṣā brāhmī sthitiḥ pārtha naināṃ prāpya vimuhyati
sthitvā'syāmantakāle'pi brahmanirvāṇamṛcchati || 103 ||

Eshaa braahmii sthitih paartha nainaam praapya vimuhyati sthitvaa'syaamantakaale'pi brahmanirvaanamrichchhati

'हे पार्थ, यह ब्राह्मी स्थिति है; इसे पाकर कोई मोह को नहीं प्राप्त होता; अन्तकाल में भी इसमें स्थित होकर मनुष्य ब्रह्मनिर्वाण को प्राप्त करता है।'

'This, Pārtha, is the state of Brahman; having reached it one is not deluded; standing in it even at the last hour one attains extinction in Brahman.'

सदद्वैतेऽनृते द्वैते यदन्योन्यैक्यवीक्षणम्
तस्यान्तकालस्तद्भेदबुद्धिरेव न चेतरः ॥ १०४ ॥

sadadvaite'nṛte dvaite yadanyonyaikyavīkṣaṇam
tasyāntakālastadbhedabuddhireva na cetaraḥ || 104 ||

Sadadvaite'nrite dvaite yadanyonyaikyaviikshanam tasyaantakaalastadbhedabuddhireva na chetarah

सत् अद्वैत और असत् द्वैत में जो परस्पर एकता का देखना है, उसका अन्तकाल उस भेद की बुद्धि ही है, और कुछ नहीं।

The last hour of the mutual identification of the true non-dual and the false dual is nothing but the knowledge of their difference.

यद्वाऽन्तकालः प्राणस्य वियोगोऽस्तु प्रसिद्धितः
तस्मिन् कालेऽपि न भ्रान्तेर्गतायाः पुनरागमः ॥ १०५ ॥

yadvā'ntakālaḥ prāṇasya viyogo'stu prasiddhitaḥ
tasmin kāle'pi na bhrāntergatāyāḥ punarāgamaḥ || 105 ||

Yadvaa'ntakaalah praanasya viyogo'stu prasiddhitah tasmin kaale'pi na bhraantergataayaah punaraagamah

अथवा प्रसिद्धि के अनुसार अन्तकाल प्राण का वियोग ही हो; उस समय भी जा चुकी भ्रान्ति का फिर लौटना नहीं होता।

Or let the last hour be, as commonly held, the departure of the breath; even then the error that has gone does not come back.

नीरोग उपविष्टो वा रुग्णो वा विलुठन् भुवि
मूर्छितो वा त्यजत्वेष प्राणान् भ्रान्तिर्न सर्वथा ॥ १०६ ॥

nīroga upaviṣṭo vā rugṇo vā viluṭhan bhuvi
mūrchito vā tyajatveṣa prāṇān bhrāntirna sarvathā || 106 ||

Niiroga upavishto vaa rugno vaa viluthan bhuvi muurchhito vaa tyajatvesha praanaan bhraantirna sarvathaa

नीरोग होकर बैठा हुआ हो, या रोगी होकर पृथ्वी पर लोटता हो, या मूर्छित हो — यह पुरुष प्राण छोड़े; भ्रान्ति किसी भी प्रकार नहीं लौटती।

Whether he be free of disease and seated, or ill and rolling on the ground, or fainting, let him give up his breath; the error does not return in any way.

दिने दिने स्वप्नसुप्त्योरधीते विस्मृतेऽप्ययम्
परेद्युर्नानधीतः स्यात्तद्वद्विद्या न नश्यति ॥ १०७ ॥

dine dine svapnasuptyoradhīte vismṛte'pyayam
paredyurnānadhītaḥ syāttadvadvidyā na naśyati || 107 ||

Dine dine svapnasuptyoradhiite vismrite'pyayam paredyurnaanadhiitah syaattadvadvidyaa na nashyati

प्रतिदिन स्वप्न और सुषुप्ति में पढ़ा हुआ भूल जाने पर भी अगले दिन मनुष्य अनपढ़ा नहीं हो जाता; वैसे ही विद्या नष्ट नहीं होती।

Day after day, though what has been learned is forgotten in dream and deep sleep, a man is not unlearned the next day; just so knowledge is not destroyed.

प्रमाणोत्पादिता विद्या प्रमाणं प्रबलं विना
न नश्यति न वेदान्तात्प्रबलं मानमीक्ष्यते ॥ १०८ ॥

pramāṇotpāditā vidyā pramāṇaṃ prabalaṃ vinā
na naśyati na vedāntātprabalaṃ mānamīkṣyate || 108 ||

Pramaanotpaaditaa vidyaa pramaanam prabalam vinaa na nashyati na vedaantaatprabalam maanamiikshyate

प्रमाण से उत्पन्न विद्या किसी अधिक बलवान् प्रमाण के बिना नष्ट नहीं होती; और वेदान्त से अधिक बलवान् प्रमाण कोई देखा नहीं जाता।

Knowledge produced by a means of knowledge is not destroyed without a stronger means of knowledge; and no means stronger than the Upaniṣads is seen.

तस्माद्वेदान्तसंसिद्धं सदद्वैतं न बाध्यते
अन्तकालेऽप्यतो भूतविवेकान्निर्वृतिः स्थिता ॥ १०९ ॥

tasmādvedāntasaṃsiddhaṃ sadadvaitaṃ na bādhyate
antakāle'pyato bhūtavivekānnirvṛtiḥ sthitā || 109 ||

Tasmaadvedaantasamsiddham sadadvaitam na baadhyate antakaale'pyato bhuutavivekaannirvritih sthitaa

इसलिए वेदान्त से सिद्ध सत् अद्वैत बाधित नहीं होता; अतः अन्तकाल में भी भूतों के विवेक से प्राप्त शान्ति बनी रहती है।

Therefore the non-dual reality established by the Upaniṣads is not set aside; so even at the last hour the peace won by the discernment of the elements stands firm.

गुहाहितं ब्रह्म यत्तत्पञ्चकोशविवेकतः
बोद्धुं शक्यं ततः कोशपञ्चकं प्रविविच्यते ॥ १ ॥

guhāhitaṃ brahma yattatpañcakośavivekataḥ
boddhuṃ śakyaṃ tataḥ kośapañcakaṃ pravivicyate || 1 ||

Guhaahitam brahma yattatpanchakoshavivekatah boddhum shakyam tatah koshapanchakam pravivichyate

जो ब्रह्म गुहा में स्थित है, वह पञ्चकोश के विवेक से जाना जा सकता है; इसलिए यहाँ पाँच कोशों का विवेचन किया जाता है।

The Brahman set in the cave can be understood through the discernment of the five sheaths; therefore the five sheaths are here separated out.

देहादभ्यन्तरः प्राणः प्राणादभ्यन्तरं मनः
ततः कर्ता ततो भोक्ता गुहा सेयं परम्परा ॥ २ ॥

dehādabhyantaraḥ prāṇaḥ prāṇādabhyantaraṃ manaḥ
tataḥ kartā tato bhoktā guhā seyaṃ paramparā || 2 ||

Dehaadabhyantarah praanah praanaadabhyantaram manah tatah kartaa tato bhoktaa guhaa seyam paramparaa

देह से भीतर प्राण है, प्राण से भीतर मन है, उससे भीतर कर्ता (विज्ञानमय) है, उससे भीतर भोक्ता (आनन्दमय) है; यही परम्परा 'गुहा' है।

Within the body is breath, within breath mind, within that the doer, within that the enjoyer; this succession is the cave.

पितृभुक्तान्नजाद्वीर्याज्जातोऽन्नेनैव वर्धते
देहः सोऽन्नमयो नात्मा प्राक् चोर्ध्वं तदभावतः ॥ ३ ॥

pitṛbhuktānnajādvīryājjāto'nnenaiva vardhate
dehaḥ so'nnamayo nātmā prāk cordhvaṃ tadabhāvataḥ || 3 ||

Pitribhuktaannajaadviiryaajjaato'nnenaiva vardhate dehah so'nnamayo naatmaa praak chordhvam tadabhaavatah

पिता के खाए हुए अन्न से बने वीर्य से उत्पन्न होकर यह देह अन्न से ही बढ़ता है; वह अन्नमय देह आत्मा नहीं, क्योंकि जन्म से पहले और मरण के बाद वह नहीं रहता।

Born of the seed formed from the food the father ate, this body grows by food alone; that body made of food is not the Self, since before birth and after death it is not.

पूर्वजन्मन्यसन्नेतज्जन्म संपादयेत्कथम्
भाविजन्मन्यसन्कर्म न भुंजीतेह सञ्चितम् ॥ ४ ॥

pūrvajanmanyasannetajjanma saṃpādayetkatham
bhāvijanmanyasankarma na bhuṃjīteha sañcitam || 4 ||

Puurvajanmanyasannetajjanma sampaadayetkatham bhaavijanmanyasankarma na bhumjiiteha sanchitam

यदि यह (देह) पूर्व जन्म में न था तो इस जन्म को कैसे उत्पन्न करता? और यदि भावी जन्म में न रहेगा तो यहाँ संचित कर्म को कौन भोगेगा?

If it was not in the former birth, how could it bring about this birth? And if it will not be in the birth to come, who will there undergo the deeds stored up here?

पूर्णो देहे बलं यच्छन्नक्षाणां यः प्रवर्तकः
वायुः प्राणमयो नासावात्मा चैतन्यवर्जनात् ॥ ५ ॥

pūrṇo dehe balaṃ yacchannakṣāṇāṃ yaḥ pravartakaḥ
vāyuḥ prāṇamayo nāsāvātmā caitanyavarjanāt || 5 ||

Puurno dehe balam yachchhannakshaanaam yah pravartakah vaayuh praanamayo naasaavaatmaa chaitanyavarjanaat

जो देह में पूर्ण रूप से भरकर बल देता है और इन्द्रियों को प्रवृत्त करता है, वह प्राणमय वायु भी आत्मा नहीं, क्योंकि वह चैतन्य से रहित है।

The air that fills the body, gives it strength and sets the organs going — that sheath of breath too is not the Self, since it is without awareness.

अहन्तां ममतां देहे गेहादौ च करोति यः
कामाद्यवस्थया भ्रान्तो नासावात्मा मनोमयः ॥ ६ ॥

ahantāṃ mamatāṃ dehe gehādau ca karoti yaḥ
kāmādyavasthayā bhrānto nāsāvātmā manomayaḥ || 6 ||

Ahantaam mamataam dehe gehaadau cha karoti yah kaamaadyavasthayaa bhraanto naasaavaatmaa manomayah

जो देह में तथा घर आदि में अहंता और ममता करता है, और काम आदि अवस्थाओं से भ्रान्त रहता है, वह मनोमय भी आत्मा नहीं है।

That which makes 'I' and 'mine' in the body and in house and the rest, and is bewildered by the states of desire and the like — that sheath of mind is not the Self either.

लीना सुप्तौ वपुर्बोधे व्याप्नुयादानखाग्रगा
चिच्छायोपेतधीर्नात्मा विज्ञानमयशब्दभाक् ॥ ७ ॥

līnā suptau vapurbodhe vyāpnuyādānakhāgragā
cicchāyopetadhīrnātmā vijñānamayaśabdabhāk || 7 ||

Liinaa suptau vapurbodhe vyaapnuyaadaanakhaagragaa chichchhaayopetadhiirnaatmaa vijnaanamayashabdabhaak

जो सुषुप्ति में लीन हो जाती है और जाग्रत् में नख के अग्रभाग तक शरीर में फैल जाती है, वह चिच्छाया से युक्त बुद्धि — 'विज्ञानमय' शब्द से कही जाने वाली — आत्मा नहीं है।

The intellect, bearing the reflection of awareness, which is dissolved in deep sleep and in waking spreads through the body to the finger-tips — called the sheath of understanding — is not the Self.

कर्तृत्वकरणत्वाभ्यां विक्रियेतान्तरिन्द्रियम्
विज्ञानमनसी अन्तर्बहिश्चैते परस्परम् ॥ ८ ॥

kartṛtvakaraṇatvābhyāṃ vikriyetāntarindriyam
vijñānamanasī antarbahiścaite parasparam || 8 ||

Kartritvakaranatvaabhyaam vikriyetaantarindriyam vijnaanamanasii antarbahishchaite parasparam

कर्तृत्व और करणत्व के कारण अन्तःकरण विकार को प्राप्त होता है; विज्ञान और मन — ये दोनों परस्पर भीतर और बाहर हैं।

The inner organ undergoes change as doer and as instrument; understanding and mind stand, each to the other, as inner and outer.

काचिदन्तर्मुखा वृत्तिरानन्दप्रतिबिम्बभाक्
पुण्यभोगे भोगशान्तौ निद्रारूपेण लीयते ॥ ९ ॥

kācidantarmukhā vṛttirānandapratibimbabhāk
puṇyabhoge bhogaśāntau nidrārūpeṇa līyate || 9 ||

Kaachidantarmukhaa vrittiraanandapratibimbabhaak punyabhoge bhogashaantau nidraaruupena liiyate

कोई एक अन्तर्मुख वृत्ति आनन्द के प्रतिबिम्ब को ग्रहण करती है; पुण्य के भोग में वह प्रकट होती है, और भोग के शान्त हो जाने पर निद्रा-रूप में लीन हो जाती है।

A certain inward-turned movement of mind takes on the reflection of bliss; in the enjoyment of merit it appears, and when the enjoyment subsides it dissolves as sleep.

कादाचित्कत्वतोऽनात्मा स्यादानन्दमयोऽप्ययम्
बिम्बभूतो य आनन्द आत्माऽसौ सर्वदा स्थितेः ॥ १० ॥

kādācitkatvato'nātmā syādānandamayo'pyayam
bimbabhūto ya ānanda ātmā'sau sarvadā sthiteḥ || 10 ||

Kaadaachitkatvato'naatmaa syaadaanandamayo'pyayam bimbabhuuto ya aananda aatmaa'sau sarvadaa sthiteh

कदाचित् ही रहने के कारण यह आनन्दमय भी आत्मा नहीं है; जो बिम्ब-रूप आनन्द है वही आत्मा है, क्योंकि वह सदा स्थित रहता है।

Because it is only occasional, this sheath of bliss too is not the Self; the bliss that is the original, not the reflection, is the Self, since it stands always.

ननु देहमुपक्रम्य निद्रानन्दान्तवस्तुषु
मा भूदात्मत्वमन्यस्तु न कश्चिदनुभूयते ॥ ११ ॥

nanu dehamupakramya nidrānandāntavastuṣu
mā bhūdātmatvamanyastu na kaścidanubhūyate || 11 ||

Nanu dehamupakramya nidraanandaantavastushu maa bhuudaatmatvamanyastu na kashchidanubhuuyate

शङ्का: देह से लेकर निद्रा के आनन्द तक की वस्तुओं में भले ही आत्मपन न हो; पर इनके सिवा कोई दूसरा तो अनुभव में आता ही नहीं।

An objection: let selfhood not belong to the things from the body up to the bliss of sleep; still, nothing else at all is experienced.

बाढं निद्रादयः सर्वेऽनुभूयन्ते न चेतरः
तथाप्येतेऽनुभूयन्ते येन तं को निवारयेत् ॥ १२ ॥

bāḍhaṃ nidrādayaḥ sarve'nubhūyante na cetaraḥ
tathāpyete'nubhūyante yena taṃ ko nivārayet || 12 ||

Baadham nidraadayah sarve'nubhuuyante na chetarah tathaapyete'nubhuuyante yena tam ko nivaarayet

उत्तर: ठीक है, निद्रा आदि सब अनुभव में आते हैं, दूसरा नहीं; फिर भी ये जिसके द्वारा अनुभूत होते हैं, उसे कौन रोक सकता है?

The answer: true, sleep and all the rest are experienced and nothing else is; yet who can ward off that by which these are experienced?

स्वयमेवानुभूतित्वाद्विद्यते नानुभाव्यता
ज्ञातृज्ञानान्तराभावादज्ञेयो न त्वसत्तया ॥ १३ ॥

svayamevānubhūtitvādvidyate nānubhāvyatā
jñātṛjñānāntarābhāvādajñeyo na tvasattayā || 13 ||

Svayamevaanubhuutitvaadvidyate naanubhaavyataa jnaatrijnaanaantaraabhaavaadajneyo na tvasattayaa

वह स्वयं अनुभूति-रूप है, इसलिए उसमें अनुभाव्यता नहीं है; जानने वाले और दूसरे ज्ञान के अभाव से वह अज्ञेय है, असत् होने से नहीं।

It is experience itself, and so is not something to be experienced; it is unknowable because there is no other knower and no other knowing — not because it is unreal.

माधुर्यादिस्वभावानामन्यत्र स्वगुणार्पिणाम्
स्वस्मिन् तदर्पणापेक्षा नो न चास्त्यन्यदर्पकम् ॥ १४ ॥

mādhuryādisvabhāvānāmanyatra svaguṇārpiṇām
svasmin tadarpaṇāpekṣā no na cāstyanyadarpakam || 14 ||

Maadhuryaadisvabhaavaanaamanyatra svagunaarpinaam svasmin tadarpanaapekshaa no na chaastyanyadarpakam

मधुरता आदि जो दूसरों को अपना गुण देते हैं, उन्हें अपने में उस गुण के अर्पण की अपेक्षा नहीं होती, और न कोई दूसरा अर्पण करने वाला होता है।

Sweetness and such, which give their own quality to other things, need no one to give that quality to themselves, nor is there another to give it.

अर्पकान्तरराहित्येप्यस्त्येषां तत्स्वभावता
मा भूत्तदानुभाव्यत्वं बोधात्मा तु न हीयते ॥ १५ ॥

arpakāntararāhityepyastyeṣāṃ tatsvabhāvatā
mā bhūttadānubhāvyatvaṃ bodhātmā tu na hīyate || 15 ||

Arpakaantararaahityepyastyeshaam tatsvabhaavataa maa bhuuttadaanubhaavyatvam bodhaatmaa tu na hiiyate

दूसरे अर्पण करने वाले के न होने पर भी उनमें वह स्वभाव रहता ही है; वैसे ही आत्मा में अनुभाव्यता भले न हो, बोधस्वरूपता नष्ट नहीं होती।

Even with no other to give it, that nature belongs to them all the same; so, though the Self is not an object of experience, its being awareness is not lost.

स्वयंज्योतिर्भवत्येष पुरोऽस्माद्भासतेऽखिलात्
तमेव भान्तमन्वेति तद्भासा भास्यते जगत् ॥ १६ ॥

svayaṃjyotirbhavatyeṣa puro'smādbhāsate'khilāt
tameva bhāntamanveti tadbhāsā bhāsyate jagat || 16 ||

Svayamjyotirbhavatyesha puro'smaadbhaasate'khilaat tameva bhaantamanveti tadbhaasaa bhaasyate jagat

यह स्वयंज्योति है; यह इस सबसे पहले भासता है; इसी के भासने पर सब उसका अनुसरण करते हैं, और इसी की आभा से यह जगत् भासित होता है।

This shines by its own light; it shines before all this; when it shines all follow after it, and by its shining this world is lit.

येनेदं जानते सर्वं तत्केनान्येन जानताम्
विज्ञातारं केन विंद्याच्छक्तं वेद्ये तु साधनम् ॥ १७ ॥

yenedaṃ jānate sarvaṃ tatkenānyena jānatām
vijñātāraṃ kena viṃdyācchaktaṃ vedye tu sādhanam || 17 ||

Yenedam jaanate sarvam tatkenaanyena jaanataam vijnaataaram kena vimdyaachchhaktam vedye tu saadhanam

'जिसके द्वारा यह सब जाना जाता है, उसे और किसके द्वारा जानें? विज्ञाता को किससे जानें?' — साधन तो जानने योग्य वस्तु के लिए ही समर्थ होता है।

'By what other could one know that by which all this is known? By what should one know the knower?' — an instrument has force only towards what is to be known.

स वेत्ति वेद्यं तत्सर्वं नान्यस्तस्यास्ति वेदिता
विदिताविदिताभ्यां तत्पृथग्बोधस्वरूपकम् ॥ १८ ॥

sa vetti vedyaṃ tatsarvaṃ nānyastasyāsti veditā
viditāviditābhyāṃ tatpṛthagbodhasvarūpakam || 18 ||

Sa vetti vedyam tatsarvam naanyastasyaasti veditaa viditaaviditaabhyaam tatprithagbodhasvaruupakam

वही उन सब जानने योग्य वस्तुओं को जानता है; उसका कोई दूसरा जानने वाला नहीं है। वह ज्ञात और अज्ञात — दोनों से पृथक्, बोधस्वरूप है।

He knows all that is to be known; there is no other knower of him. He is other than both the known and the unknown, and his nature is awareness.

बोधेऽप्यनुभवो यस्य न कथंचन जायते
तं कथं बोधयेच्छास्त्रं लोष्टं नरसमाकृतिम् ॥ १९ ॥

bodhe'pyanubhavo yasya na kathaṃcana jāyate
taṃ kathaṃ bodhayecchāstraṃ loṣṭaṃ narasamākṛtim || 19 ||

Bodhe'pyanubhavo yasya na kathamchana jaayate tam katham bodhayechchhaastram loshtam narasamaakritim

बोध होने पर भी जिसे किसी प्रकार अनुभव नहीं होता, उसे शास्त्र कैसे समझाए? वह तो मनुष्य के आकार का मिट्टी का ढेला है।

How should scripture teach one to whom, even when it is set out, no experience comes at all? He is a clod of earth shaped like a man.

जिह्वा मेऽस्ति न वेत्युक्तिर्लज्जायै केवलं यथा
न बुध्यते मया बोधो बोद्धव्य इति तादृशी ॥ २० ॥

jihvā me'sti na vetyuktirlajjāyai kevalaṃ yathā
na budhyate mayā bodho boddhavya iti tādṛśī || 20 ||

Jihvaa me'sti na vetyuktirlajjaayai kevalam yathaa na budhyate mayaa bodho boddhavya iti taadrishii

'मेरी जीभ है या नहीं' — ऐसा कहना केवल लज्जा का कारण है; वैसी ही यह बात है कि 'मुझे बोध नहीं होता, बोध जानने योग्य है'।

'Have I a tongue or not?' — such a question brings only shame; and of the same kind is 'I do not know awareness, awareness is to be known'.

यस्मिन्यस्मिन्नस्ति लोके बोधस्तत्तदुपेक्षणे
यद्बोधमात्रं तद्ब्रह्मेत्येवं धीर्ब्रह्मनिश्चयः ॥ २१ ॥

yasminyasminnasti loke bodhastattadupekṣaṇe
yadbodhamātraṃ tadbrahmetyevaṃ dhīrbrahmaniścayaḥ || 21 ||

Yasminyasminnasti loke bodhastattadupekshane yadbodhamaatram tadbrahmetyevam dhiirbrahmanishchayah

जिस-जिस वस्तु में लोक में बोध है, उस-उसकी उपेक्षा कर देने पर जो केवल बोधमात्र रह जाता है, वही ब्रह्म है — यही बुद्धि ब्रह्म का निश्चय है।

Setting aside each thing in the world in which awareness is found, what remains as mere awareness is Brahman — such a conviction is the certainty of Brahman.

पञ्चकोशपरित्यागे साक्षिबोधावशेषतः
स्वस्वरूपं स एव स्याच्छून्यत्वं तस्य दुर्घटम् ॥ २२ ॥

pañcakośaparityāge sākṣibodhāvaśeṣataḥ
svasvarūpaṃ sa eva syācchūnyatvaṃ tasya durghaṭam || 22 ||

Panchakoshaparityaage saakshibodhaavasheshatah svasvaruupam sa eva syaachchhuunyatvam tasya durghatam

पाँचों कोशों के त्याग से जब केवल साक्षी-बोध शेष रहता है, वही अपना स्वरूप है; उसका शून्य होना असम्भव है।

When the five sheaths are given up and the witnessing awareness alone is left, that is one's own nature; that it should be a void is impossible.

अस्ति तावत्स्वयं नाम विवादाविषयत्वतः
स्वस्मिन्नपि विवादश्चेत् प्रतिवाद्यत्र को भवेत् ॥ २३ ॥

asti tāvatsvayaṃ nāma vivādāviṣayatvataḥ
svasminnapi vivādaścet prativādyatra ko bhavet || 23 ||

Asti taavatsvayam naama vivaadaavishayatvatah svasminnapi vivaadashchet prativaadyatra ko bhavet

'स्वयं' तो है ही, क्योंकि वह विवाद का विषय नहीं हो सकता; और यदि अपने विषय में भी विवाद हो, तो यहाँ प्रतिवादी कौन होगा?

'Oneself' surely is, since it cannot be the subject of dispute; and if there were a dispute about oneself, who here would be the opponent?

स्वासत्त्वं तु न कस्मैचिद्रोचते विभ्रमं विना
अत एव श्रुतिर्बाधं ब्रूते चासत्ववादिनः ॥ २४ ॥

svāsattvaṃ tu na kasmaicidrocate vibhramaṃ vinā
ata eva śrutirbādhaṃ brūte cāsatvavādinaḥ || 24 ||

Svaasattvam tu na kasmaichidrochate vibhramam vinaa ata eva shrutirbaadham bruute chaasatvavaadinah

अपना न होना भ्रम के बिना किसी को नहीं रुचता; इसीलिए श्रुति असत् कहने वालों का खण्डन करती है।

No one without delusion likes the thought of his own non-being; and therefore scripture declares the refutation of those who say it is unreal.

असद्ब्रह्मेति चेद्वेद स्वयमेव भवेदसत्
अतोऽस्य माभूद्वेद्यत्वं स्वसत्त्वं त्वभ्युपेयताम् ॥ २५ ॥

asadbrahmeti cedveda svayameva bhavedasat
ato'sya mābhūdvedyatvaṃ svasattvaṃ tvabhyupeyatām || 25 ||

Asadbrahmeti chedveda svayameva bhavedasat ato'sya maabhuudvedyatvam svasattvam tvabhyupeyataam

'यदि कोई ब्रह्म को असत् जाने तो वह स्वयं ही असत् हो जाता है' — अतः इसका वेद्य होना न हो, पर इसकी अपनी सत्ता तो स्वीकार करनी ही चाहिए।

'If one knows Brahman to be unreal, he himself becomes unreal' — so let it not be an object of knowledge, but its own being must be granted.

कीदृक्तर्हीति चेत्पृच्छेदीदृक्ता नास्ति तत्र हि
यदनीदृगतादृक् च तत्स्वरूपं विनिश्चिनु ॥ २६ ॥

kīdṛktarhīti cetpṛcchedīdṛktā nāsti tatra hi
yadanīdṛgatādṛk ca tatsvarūpaṃ viniścinu || 26 ||

Kiidriktarhiiti chetprichchhediidriktaa naasti tatra hi yadaniidrigataadrik cha tatsvaruupam vinishchinu

यदि पूछो 'तब वह कैसा है?' — तो उसमें 'ऐसा' कहा जा सके, ऐसा कुछ नहीं है; जो न ऐसा है न वैसा, उसी को उसका स्वरूप निश्चित करो।

If you ask 'of what sort is it then?' — there is in it nothing of which 'such' can be said; settle its nature as that which is neither this sort nor that.

अक्षाणां विषयस्त्वीदृक् परोक्षस्तादृगुच्यते
विषयी नाक्षविषयः स्वत्वान्नास्य परोक्षता ॥ २७ ॥

akṣāṇāṃ viṣayastvīdṛk parokṣastādṛgucyate
viṣayī nākṣaviṣayaḥ svatvānnāsya parokṣatā || 27 ||

Akshaanaam vishayastviidrik parokshastaadriguchyate vishayii naakshavishayah svatvaannaasya parokshataa

इन्द्रियों का विषय 'ईदृक्' (ऐसा) कहलाता है और परोक्ष 'तादृक्' (वैसा); विषयी इन्द्रियों का विषय नहीं है, और स्वयं होने के कारण उसमें परोक्षता भी नहीं है।

What the organs grasp is called 'of this sort', and what is beyond them 'of that sort'; the subject is not grasped by the organs, and being oneself, it is not beyond them either.

अवेद्योऽप्यपरोक्षोऽतः स्वप्रकाशो भवत्ययम्
सत्यं ज्ञानमनन्तं चेत्यस्तीह ब्रह्मलक्षणम् ॥ २८ ॥

avedyo'pyaparokṣo'taḥ svaprakāśo bhavatyayam
satyaṃ jñānamanantaṃ cetyastīha brahmalakṣaṇam || 28 ||

Avedyo'pyaparoksho'tah svaprakaasho bhavatyayam satyam jnaanamanantam chetyastiiha brahmalakshanam

इस प्रकार वेद्य न होकर भी यह अपरोक्ष है, अतः स्वयंप्रकाश है। 'सत्य, ज्ञान, अनन्त' — यह ब्रह्म का लक्षण यहाँ है।

So, though not an object of knowledge, it is directly present, and therefore self-luminous. 'Truth, knowledge, the endless' — this is the mark of Brahman given here.

सत्यत्वं बाधराहित्यं जगद्बाधैकसाक्षिणः
बाधः किंसाक्षिको ब्रूहि न त्वसाक्षिक इष्यते ॥ २९ ॥

satyatvaṃ bādharāhityaṃ jagadbādhaikasākṣiṇaḥ
bādhaḥ kiṃsākṣiko brūhi na tvasākṣika iṣyate || 29 ||

Satyatvam baadharaahityam jagadbaadhaikasaakshinah baadhah kimsaakshiko bruuhi na tvasaakshika ishyate

सत्यता का अर्थ है बाध का न होना; जगत् के बाध का एकमात्र साक्षी जो है, उसका बाध किसका साक्षी होकर होगा — बताओ? साक्षी के बिना बाध माना ही नहीं जाता।

Truth means freedom from being set aside; tell us, with what witness could the one sole witness of the world's setting-aside be himself set aside? No setting-aside is allowed without a witness.

अपनीतेषु मूर्तेषु ह्यमूर्त शिष्यते वियत्
शक्येषु बाधितेष्वन्ते शिष्यते यत्तदेव तत् ॥ ३० ॥

apanīteṣu mūrteṣu hyamūrta śiṣyate viyat
śakyeṣu bādhiteṣvante śiṣyate yattadeva tat || 30 ||

Apaniiteshu muurteshu hyamuurta shishyate viyat shakyeshu baadhiteshvante shishyate yattadeva tat

मूर्त वस्तुओं के हटा देने पर अमूर्त आकाश शेष रहता है; वैसे ही जितने बाध्य हैं उन सबके बाधित हो जाने पर अन्त में जो शेष रहता है, वही वह है।

When solid things are removed, formless space is left; so, when all that can be set aside has at last been set aside, what is left is just That.

सर्वबाधे न किञ्चिच्चेद्यन्न किञ्चित्तदेव तत्
भाषा एवात्र भिद्यन्ते निर्बाधं तावदस्ति हि ॥ ३१ ॥

sarvabādhe na kiñciccedyanna kiñcittadeva tat
bhāṣā evātra bhidyante nirbādhaṃ tāvadasti hi || 31 ||

Sarvabaadhe na kinchichchedyanna kinchittadeva tat bhaashaa evaatra bhidyante nirbaadham taavadasti hi

यदि कहो कि सबके बाध पर कुछ भी नहीं रहता — तो जो 'कुछ भी नहीं' है वही वह है। यहाँ केवल भाषाएँ भिन्न हैं; बाध-रहित कुछ तो है ही।

If you say that when all is set aside nothing remains, then that 'nothing' is just That. Here only the words differ; something free of setting-aside there surely is.

अत एव श्रुतिर्बाध्यं बाधित्वा शेषयत्यदः
स एष नेति नेत्यात्मेत्यतद्व्यावृत्तिरूपतः ॥ ३२ ॥

ata eva śrutirbādhyaṃ bādhitvā śeṣayatyadaḥ
sa eṣa neti netyātmetyatadvyāvṛttirūpataḥ || 32 ||

Ata eva shrutirbaadhyam baadhitvaa sheshayatyadah sa esha neti netyaatmetyatadvyaavrittiruupatah

इसीलिए श्रुति बाध्य का बाध करके उस (आत्मा) को शेष रखती है — 'वह यह आत्मा "नेति नेति" (यह नहीं, यह नहीं) है' — इस प्रकार अतद् की व्यावृत्ति के रूप में।

Therefore scripture, setting aside what can be set aside, leaves That over — 'that Self is not this, not this' — by the way of excluding what it is not.

इदं रूपन्तु यद्यावत्तत्त्यक्तुं शक्यतेऽखिलम्
अशक्योऽह्यनिदंरूपः स आत्मा बाधवर्जितः ॥ ३३ ॥

idaṃ rūpantu yadyāvattattyaktuṃ śakyate'khilam
aśakyo'hyanidaṃrūpaḥ sa ātmā bādhavarjitaḥ || 33 ||

Idam ruupantu yadyaavattattyaktum shakyate'khilam ashakyo'hyanidamruupah sa aatmaa baadhavarjitah

जो कुछ भी 'इदम्' रूप है, वह सब छोड़ा जा सकता है; जो अनिदम्-रूप है वह नहीं छोड़ा जा सकता — वही बाध से रहित आत्मा है।

Whatever has the form of 'this' can all be given up; what has not the form of 'this' cannot be given up — that is the Self, free of being set aside.

सिद्धं ब्रह्मणि सत्यत्वं ज्ञानत्वं तु पुरेरितम्
स्वयमेवानुभूतित्वादित्यादिवचनैः स्फुटम् ॥ ३४ ॥

siddhaṃ brahmaṇi satyatvaṃ jñānatvaṃ tu pureritam
svayamevānubhūtitvādityādivacanaiḥ sphuṭam || 34 ||

Siddham brahmani satyatvam jnaanatvam tu pureritam svayamevaanubhuutitvaadityaadivachanaih sphutam

इस प्रकार ब्रह्म में सत्यता सिद्ध हुई; ज्ञानत्व तो पहले ही 'स्वयं ही अनुभूति-रूप होने से' आदि वचनों से स्पष्ट कहा जा चुका है।

Thus truth is established in Brahman; its being knowledge was already made plain by such words as 'because it is experience itself'.

न व्यापित्वाद्देशतोऽन्तो नित्यत्वान्नापि कालतः
न वस्तुतोऽपि सार्वात्म्यादानन्त्यं ब्रह्मणि त्रिधा ॥ ३५ ॥

na vyāpitvāddeśato'nto nityatvānnāpi kālataḥ
na vastuto'pi sārvātmyādānantyaṃ brahmaṇi tridhā || 35 ||

Na vyaapitvaaddeshato'nto nityatvaannaapi kaalatah na vastuto'pi saarvaatmyaadaanantyam brahmani tridhaa

व्यापक होने से देश की दृष्टि से उसका अन्त नहीं, नित्य होने से काल की दृष्टि से नहीं, और सर्वात्मक होने से वस्तु की दृष्टि से भी नहीं — इस प्रकार ब्रह्म में अनन्तता तीन प्रकार की है।

Being all-pervading it has no end in space, being eternal none in time, and being the Self of all none in respect of other things; thus endlessness in Brahman is of three kinds.

देशकालान्यवस्तूनां कल्पितत्वाच्च मायया
न देशादिकृतोऽन्तोऽस्ति ब्रह्मानन्त्यं स्फुटं ततः ॥ ३६ ॥

deśakālānyavastūnāṃ kalpitatvācca māyayā
na deśādikṛto'nto'sti brahmānantyaṃ sphuṭaṃ tataḥ || 36 ||

Deshakaalaanyavastuunaam kalpitatvaachcha maayayaa na deshaadikrito'nto'sti brahmaanantyam sphutam tatah

देश, काल और अन्य वस्तुएँ माया से कल्पित हैं, इसलिए देश आदि से किया हुआ कोई अन्त नहीं है; इससे ब्रह्म की अनन्तता स्पष्ट है।

Space, time and other things are imagined by illusion, so there is no end brought about by space and the rest; hence the endlessness of Brahman is plain.

सत्यं ज्ञानमनन्तं यद्ब्रह्म तद्वस्तु तस्य तत्
ईश्वरत्वं च जीवत्वमुपाधिद्वयकल्पितम् ॥ ३७ ॥

satyaṃ jñānamanantaṃ yadbrahma tadvastu tasya tat
īśvaratvaṃ ca jīvatvamupādhidvayakalpitam || 37 ||

Satyam jnaanamanantam yadbrahma tadvastu tasya tat iishvaratvam cha jiivatvamupaadhidvayakalpitam

सत्य, ज्ञान और अनन्त जो ब्रह्म है, वह उसकी वस्तु-स्थिति है; ईश्वरत्व और जीवत्व तो दो उपाधियों से कल्पित हैं।

Brahman as truth, knowledge and the endless is what it is in itself; its lordship and its individuality are imagined by two limiting adjuncts.

शक्तिरस्त्यैश्वरी काचित्सर्ववस्तुनियामिका
आनन्दमयमारभ्य गूढा सर्वेषु वस्तुषु ॥ ३८ ॥

śaktirastyaiśvarī kācitsarvavastuniyāmikā
ānandamayamārabhya gūḍhā sarveṣu vastuṣu || 38 ||

Shaktirastyaishvarii kaachitsarvavastuniyaamikaa aanandamayamaarabhya guudhaa sarveshu vastushu

कोई एक ऐश्वरी शक्ति है जो सब वस्तुओं का नियमन करती है; आनन्दमय से लेकर सब वस्तुओं में वह गूढ़ रूप से रहती है।

There is a lordly power which governs all things; from the sheath of bliss downward it lies hidden in all things.

वस्तुधर्मा नियम्येरन् शक्तया नैव यदा तदा
अन्योन्यधर्मसांकर्याद्विप्लवेत जगत् खलु ॥ ३९ ॥

vastudharmā niyamyeran śaktayā naiva yadā tadā
anyonyadharmasāṃkaryādviplaveta jagat khalu || 39 ||

Vastudharmaa niyamyeran shaktayaa naiva yadaa tadaa anyonyadharmasaamkaryaadviplaveta jagat khalu

जब यह शक्ति वस्तुओं के धर्मों का नियमन न करे, तब परस्पर धर्मों के मिल जाने से जगत् में अवश्य उथल-पुथल हो जाए।

Were this power not to govern the properties of things, the world would surely fall into confusion through the mixing of one another's properties.

चिच्छायावेशतः शक्तिश्चेतनेव विभाति सा
तच्छक्त्त्युपाधिसंयोगाद्ब्रह्मैवेश्वरतां व्रजेत् ॥ ४० ॥

cicchāyāveśataḥ śaktiścetaneva vibhāti sā
tacchakttyupādhisaṃyogādbrahmaiveśvaratāṃ vrajet || 40 ||

Chichchhaayaaveshatah shaktishchetaneva vibhaati saa tachchhakttyupaadhisamyogaadbrahmaiveshvarataam vrajet

चित् की छाया के प्रवेश से वह शक्ति चेतन-सी भासती है; उस शक्ति-रूप उपाधि के संयोग से ब्रह्म ही ईश्वरता को प्राप्त होता है।

Through the entry of the reflection of awareness that power seems as though conscious; by union with that power as limiting adjunct Brahman itself comes to be the Lord.

कोशोपाधिविवक्षायां याति ब्रह्मैव जीवताम्
पिता पितामहश्चैकः पुत्रपौत्रौ यथा प्रति ॥ ४१ ॥

kośopādhivivakṣāyāṃ yāti brahmaiva jīvatām
pitā pitāmahaścaikaḥ putrapautrau yathā prati || 41 ||

Koshopaadhivivakshaayaam yaati brahmaiva jiivataam pitaa pitaamahashchaikah putrapautrau yathaa prati

कोशों को उपाधि मानने की विवक्षा में ब्रह्म ही जीवत्व को प्राप्त होता है — जैसे एक ही व्यक्ति पुत्र और पौत्र की अपेक्षा से पिता और पितामह होता है।

When the sheaths are spoken of as limiting adjuncts, Brahman itself comes to be the individual — as one and the same man is father and grandfather with reference to son and grandson.

पुत्रादेरविवक्षायां न पिता न पितामहः
तद्वन्नेशो नापि जीवः शक्तिकोशाविवक्षणे ॥ ४२ ॥

putrāderavivakṣāyāṃ na pitā na pitāmahaḥ
tadvanneśo nāpi jīvaḥ śaktikośāvivakṣaṇe || 42 ||

Putraaderavivakshaayaam na pitaa na pitaamahah tadvannesho naapi jiivah shaktikoshaavivakshane

पुत्र आदि की विवक्षा न हो तो न पिता है न पितामह; वैसे ही शक्ति और कोशों की विवक्षा न हो तो न ईश्वर है न जीव।

If son and the rest are not spoken of, there is neither father nor grandfather; so, if the power and the sheaths are not spoken of, there is neither Lord nor individual.

य एवं ब्रह्म वेदैष ब्रह्मैव भवति स्वयम्
ब्रह्मणो नास्ति जन्मातः पुनरेष न जायते ॥ ४३ ॥

ya evaṃ brahma vedaiṣa brahmaiva bhavati svayam
brahmaṇo nāsti janmātaḥ punareṣa na jāyate || 43 ||

Ya evam brahma vedaisha brahmaiva bhavati svayam brahmano naasti janmaatah punaresha na jaayate

जो इस प्रकार ब्रह्म को जानता है, वह स्वयं ब्रह्म ही हो जाता है; ब्रह्म का जन्म नहीं होता, अतः वह फिर जन्म नहीं लेता।

He who knows Brahman thus becomes Brahman himself; Brahman has no birth, and therefore he is not born again.

ईश्वरेणापि जीवेन सृष्टं द्वैतम् विविच्यते
विवेके सति जीवेन हेयो बंधः स्फुटीभवेत् ॥ १ ॥

īśvareṇāpi jīvena sṛṣṭaṃ dvaitam vivicyate
viveke sati jīvena heyo baṃdhaḥ sphuṭībhavet || 1 ||

Iishvarenaapi jiivena srishtam dvaitam vivichyate viveke sati jiivena heyo bamdhah sphutiibhavet

ईश्वर के द्वारा और जीव के द्वारा रचे हुए द्वैत का यहाँ विवेक किया जाता है; विवेक होने पर जीव के द्वारा त्यागने योग्य बन्धन स्पष्ट हो जाएगा।

The duality created by the Lord and that created by the individual are here distinguished; when they are distinguished, the bondage the individual must give up becomes plain.

मायां तु प्रकृतिं विन्द्यान्मायिनं तु महेश्वरम्
स मायी सृजतीत्याहुः श्वेताश्वतरशाखिनः ॥ २ ॥

māyāṃ tu prakṛtiṃ vindyānmāyinaṃ tu maheśvaram
sa māyī sṛjatītyāhuḥ śvetāśvataraśākhinaḥ || 2 ||

Maayaam tu prakritim vindyaanmaayinam tu maheshvaram sa maayii srijatiityaahuh shvetaashvatarashaakhinah

'माया को प्रकृति जानो और मायी को महेश्वर; वह मायी सृष्टि करता है' — ऐसा श्वेताश्वतर शाखा वाले कहते हैं।

'Know illusion to be nature and the wielder of illusion to be the great Lord; that wielder creates' — so say the followers of the Śvetāśvatara branch.

आत्मा वा इदमग्रेऽभूत्स ईक्षत सृजा इति
संकल्पेनासृजल्लोकान् स एतानिति बह्वृचाः ॥ ३ ॥

ātmā vā idamagre'bhūtsa īkṣata sṛjā iti
saṃkalpenāsṛjallokān sa etāniti bahvṛcāḥ || 3 ||

Aatmaa vaa idamagre'bhuutsa iikshata srijaa iti samkalpenaasrijallokaan sa etaaniti bahvrichaah

'पहले यह सब आत्मा ही था; उसने देखा — मैं सृष्टि करूँ; संकल्प से उसने इन लोकों को रचा' — ऐसा ऋग्वेदी कहते हैं।

'In the beginning all this was the Self alone; he looked and thought, let me create; by his will he created these worlds' — so say the Ṛgvedins.

खं वाय्वग्निजलोर्व्योषध्यन्नदेहाः क्रमादमी
संभूता ब्रह्मणस्तस्मादेतस्मादात्मनोऽखिलाः ॥ ४ ॥

khaṃ vāyvagnijalorvyoṣadhyannadehāḥ kramādamī
saṃbhūtā brahmaṇastasmādetasmādātmano'khilāḥ || 4 ||

Kham vaayvagnijalorvyoshadhyannadehaah kramaadamii sambhuutaa brahmanastasmaadetasmaadaatmano'khilaah

आकाश, वायु, अग्नि, जल, पृथ्वी, ओषधि, अन्न और देह — ये सब क्रमशः उसी ब्रह्म से, उसी आत्मा से उत्पन्न हुए।

Space, air, fire, water, earth, plants, food and bodies — all these arose in order from that Brahman, from that very Self.

बहु स्यामहमेवातः प्रजायेयेति कामतः
तपस्तप्त्वाऽसृजत्सर्वं जगदित्याह तित्तिरिः ॥ ५ ॥

bahu syāmahamevātaḥ prajāyeyeti kāmataḥ
tapastaptvā'sṛjatsarvaṃ jagadityāha tittiriḥ || 5 ||

Bahu syaamahamevaatah prajaayeyeti kaamatah tapastaptvaa'srijatsarvam jagadityaaha tittirih

'मैं बहुत हो जाऊँ, इसलिए उत्पन्न होऊँ' — इस कामना से तप करके उसने सारा जगत् रचा — ऐसा तैत्तिरीय कहते हैं।

'Let me be many, therefore let me be born' — with this desire he performed austerity and created the whole world, says the Taittirīya.

इदमग्रे सदेवाऽसीत् बहुत्वाय तदैक्षत
तेजोऽबन्नांडजादीनि ससर्जेति च सामगाः ॥ ६ ॥

idamagre sadevā'sīt bahutvāya tadaikṣata
tejo'bannāṃḍajādīni sasarjeti ca sāmagāḥ || 6 ||

Idamagre sadevaa'siit bahutvaaya tadaikshata tejo'bannaamdajaadiini sasarjeti cha saamagaah

'पहले यह सत् ही था; बहुत होने के लिए उसने देखा; और उसने तेज, जल, अन्न तथा अण्डज आदि की सृष्टि की' — ऐसा सामवेदी कहते हैं।

'In the beginning this was being alone; it looked, wishing to be many; and it created fire, water, food and the egg-born and the rest' — so say the singers of the Sāman.

विस्फुलिंगा यथा वह्नेर्जायन्तेऽक्षरतस्तथा
विविधाश्चिज्जडा भावा इत्याथर्वणिकी श्रुतिः ॥ ७ ॥

visphuliṃgā yathā vahnerjāyante'kṣaratastathā
vividhāścijjaḍā bhāvā ityātharvaṇikī śrutiḥ || 7 ||

Visphulimgaa yathaa vahnerjaayante'ksharatastathaa vividhaashchijjadaa bhaavaa ityaatharvanikii shrutih

'जैसे अग्नि से चिनगारियाँ उत्पन्न होती हैं, वैसे ही अक्षर से नाना प्रकार के चेतन और जड़ भाव उत्पन्न होते हैं' — यह अथर्ववेद की श्रुति है।

'As sparks arise from fire, so from the imperishable arise manifold beings, conscious and unconscious' — this is the scripture of the Atharvan.

जगदव्याकृतं पूर्वमासीद्व्याक्रियताधुना
दृश्याभ्यां नामरूपाभ्यां विराडादिषु ते स्फुटे ॥ ८ ॥

jagadavyākṛtaṃ pūrvamāsīdvyākriyatādhunā
dṛśyābhyāṃ nāmarūpābhyāṃ virāḍādiṣu te sphuṭe || 8 ||

Jagadavyaakritam puurvamaasiidvyaakriyataadhunaa drishyaabhyaam naamaruupaabhyaam viraadaadishu te sphute

'जगत् पहले अव्याकृत था, अब व्याकृत हुआ है; दृश्य नाम और रूप से विराट् आदि में वे दोनों स्पष्ट हैं।'

'The world was formerly undifferentiated; now it has been differentiated. By the visible name and form the two are plain in the cosmic person and the rest.'

विराण्मनुर्नरा गावः खराक्ष्वाजादयस्तथा
पिपीलिकावधि द्वंद्वमिति वाजसनेयिनः ॥ ९ ॥

virāṇmanurnarā gāvaḥ kharākṣvājādayastathā
pipīlikāvadhi dvaṃdvamiti vājasaneyinaḥ || 9 ||

Viraanmanurnaraa gaavah kharaakshvaajaadayastathaa pipiilikaavadhi dvamdvamiti vaajasaneyinah

'विराट्, मनु, मनुष्य, गौ, गधा, घोड़ा, बकरी आदि से लेकर चींटी तक जोड़े-जोड़े में' — ऐसा वाजसनेयी कहते हैं।

'The cosmic person, Manu, men, cattle, asses, horses, goats and the rest, down to the ant, in pairs' — so say the followers of the Vājasaneyi.

कृत्वा रूपान्तरं जैवं देहे प्राविशदीश्वरः
इति ताः श्रुतयः प्राहुर्जीवत्वं प्राणधारणात् ॥ १० ॥

kṛtvā rūpāntaraṃ jaivaṃ dehe prāviśadīśvaraḥ
iti tāḥ śrutayaḥ prāhurjīvatvaṃ prāṇadhāraṇāt || 10 ||

Kritvaa ruupaantaram jaivam dehe praavishadiishvarah iti taah shrutayah praahurjiivatvam praanadhaaranaat

'जीव का दूसरा रूप बनाकर ईश्वर देह में प्रविष्ट हुआ' — ये श्रुतियाँ ऐसा कहती हैं; प्राण धारण करने से उसका जीवत्व है।

'Making another form, that of the individual, the Lord entered into the body' — so these scriptures say; its being a living soul comes from its holding the breath.

चैतन्यं यदधिष्ठानं लिंगदेहश्च यः पुनः
चिच्छाया लिंगदेहस्था तत्संघो जीव उच्यते ॥ ११ ॥

caitanyaṃ yadadhiṣṭhānaṃ liṃgadehaśca yaḥ punaḥ
cicchāyā liṃgadehasthā tatsaṃgho jīva ucyate || 11 ||

Chaitanyam yadadhishthaanam limgadehashcha yah punah chichchhaayaa limgadehasthaa tatsamgho jiiva uchyate

जो अधिष्ठान-रूप चैतन्य है, और जो लिङ्ग-शरीर है, तथा लिङ्ग-शरीर में पड़ी चित् की छाया — इन तीनों का संघात जीव कहलाता है।

The awareness that is the ground, the subtle body, and the reflection of awareness lying in the subtle body — the collection of these is called the individual soul.

माहेश्वरीतु माया या तस्या निर्माणशक्तिवत्
विद्यते मोहशक्तिश्च तं जीवं मोहयत्यसौ ॥ १२ ॥

māheśvarītu māyā yā tasyā nirmāṇaśaktivat
vidyate mohaśaktiśca taṃ jīvaṃ mohayatyasau || 12 ||

Maaheshvariitu maayaa yaa tasyaa nirmaanashaktivat vidyate mohashaktishcha tam jiivam mohayatyasau

जो माहेश्वरी माया है, उसमें निर्माण-शक्ति की तरह मोह-शक्ति भी है; वह उस जीव को मोहित करती है।

In the illusion that belongs to the great Lord there is, besides the power of making, a power of bewildering; and it bewilders that soul.

मोहादनीशतां प्राप्य मग्नो वपुषि शोचति
ईशसृष्टमिदं द्वैतं सर्वमुक्तं समासतः ॥ १३ ॥

mohādanīśatāṃ prāpya magno vapuṣi śocati
īśasṛṣṭamidaṃ dvaitaṃ sarvamuktaṃ samāsataḥ || 13 ||

Mohaadaniishataam praapya magno vapushi shochati iishasrishtamidam dvaitam sarvamuktam samaasatah

मोह से अनीश्वरता को प्राप्त होकर, शरीर में डूबा हुआ वह शोक करता है। ईश्वर के रचे हुए इस द्वैत को संक्षेप में सब कह दिया गया।

Through bewilderment he comes to be without power, and sunk in the body he grieves. The duality created by the Lord has now been told in brief.

सप्तान्नब्राह्मणे द्वैतं जीवसृष्टं प्रपंचितम्
अन्नानि सप्त ज्ञानेन कर्मणाऽजनयत्पिता ॥ १४ ॥

saptānnabrāhmaṇe dvaitaṃ jīvasṛṣṭaṃ prapaṃcitam
annāni sapta jñānena karmaṇā'janayatpitā || 14 ||

Saptaannabraahmane dvaitam jiivasrishtam prapamchitam annaani sapta jnaanena karmanaa'janayatpitaa

सप्तान्न-ब्राह्मण में जीव के रचे हुए द्वैत का विस्तार किया गया है — 'पिता ने ज्ञान और कर्म से सात अन्न उत्पन्न किए।'

In the section on the seven foods the duality created by the individual is set out at length — 'the father produced the seven foods by knowledge and by action'.

मर्त्यान्नमेकं देवान्ने द्वे पश्वन्नं चतुर्धकम्
अन्यत्त्रितयमात्मार्थमन्नानां विनियोजनम् ॥ १५ ॥

martyānnamekaṃ devānne dve paśvannaṃ caturdhakam
anyattritayamātmārthamannānāṃ viniyojanam || 15 ||

Martyaannamekam devaanne dve pashvannam chaturdhakam anyattritayamaatmaarthamannaanaam viniyojanam

एक मर्त्यों का अन्न, दो देवों के अन्न, एक चौथा पशुओं का अन्न; शेष तीन आत्मा के लिए हैं — यही अन्नों का विनियोग है।

One is the food of mortals, two the food of the gods, a fourth the food of animals; the remaining three are for the Self — such is the allotment of the foods.

व्रीह्यादिकं दर्शपूर्णमासौ क्षीरं तथा मनः
वाक् प्राणश्चेति सप्तत्वमन्नानामवगम्यताम् ॥ १६ ॥

vrīhyādikaṃ darśapūrṇamāsau kṣīraṃ tathā manaḥ
vāk prāṇaśceti saptatvamannānāmavagamyatām || 16 ||

Vriihyaadikam darshapuurnamaasau kshiiram tathaa manah vaak praanashcheti saptatvamannaanaamavagamyataam

व्रीहि आदि, दर्श और पूर्णमास, दूध, तथा मन, वाणी और प्राण — इस प्रकार अन्नों का सातपन समझना चाहिए।

Rice and the rest, the new-moon and full-moon offerings, milk, and mind, speech and breath — thus the sevenfoldness of the foods is to be understood.

ईशेन यद्यप्येतानि निर्मितानि स्वरूपतः
तथापि ज्ञानकर्मभ्यां जीवोऽकार्षीत्तदन्नताम् ॥ १७ ॥

īśena yadyapyetāni nirmitāni svarūpataḥ
tathāpi jñānakarmabhyāṃ jīvo'kārṣīttadannatām || 17 ||

Iishena yadyapyetaani nirmitaani svaruupatah tathaapi jnaanakarmabhyaam jiivo'kaarshiittadannataam

यद्यपि ये सब स्वरूप से ईश्वर के द्वारा बनाए गए हैं, तथापि ज्ञान और कर्म से जीव ने इन्हें अन्न-रूप बनाया।

Though these were made in their own nature by the Lord, yet it was the individual who by knowledge and action made them food.

ईशकार्यं जीवभोग्यं जगद्द्वाभ्यां समन्वितम्
पितृजन्या भर्तृभोग्या यथा योषित्तथेष्यताम् ॥ १८ ॥

īśakāryaṃ jīvabhogyaṃ jagaddvābhyāṃ samanvitam
pitṛjanyā bhartṛbhogyā yathā yoṣittatheṣyatām || 18 ||

Iishakaaryam jiivabhogyam jagaddvaabhyaam samanvitam pitrijanyaa bhartribhogyaa yathaa yoshittatheshyataam

जगत् ईश्वर का कार्य है और जीव का भोग्य; वह दोनों से युक्त है — जैसे स्त्री पिता से उत्पन्न होती है और पति की भोग्या होती है।

The world is the Lord's work and the individual's object of enjoyment, and so belongs to both — as a woman is born of her father and is enjoyed by her husband.

मायावृत्यात्मको हीशसंकल्पः साधनं जनौ
मनोवृत्त्यात्मको जीवसंकल्पो भोगसाधनम् ॥ १९ ॥

māyāvṛtyātmako hīśasaṃkalpaḥ sādhanaṃ janau
manovṛttyātmako jīvasaṃkalpo bhogasādhanam || 19 ||

Maayaavrityaatmako hiishasamkalpah saadhanam janau manovrittyaatmako jiivasamkalpo bhogasaadhanam

माया की वृत्ति-रूप ईश्वर का संकल्प उत्पत्ति का साधन है; और मन की वृत्ति-रूप जीव का संकल्प भोग का साधन है।

The Lord's will, which is a movement of illusion, is the means of the world's coming to be; the individual's will, which is a movement of mind, is the means of enjoyment.

ईशनिर्मितमण्यादौ वस्तुन्येकविधे स्थिते
भोक्तृधीवृत्तिनानात्त्वात्तद्भोगो बहुधेष्यते ॥ २० ॥

īśanirmitamaṇyādau vastunyekavidhe sthite
bhoktṛdhīvṛttinānāttvāttadbhogo bahudheṣyate || 20 ||

Iishanirmitamanyaadau vastunyekavidhe sthite bhoktridhiivrittinaanaattvaattadbhogo bahudheshyate

ईश्वर के बनाए मणि आदि की वस्तु एक ही प्रकार की रहने पर भी, भोक्ताओं की बुद्धि-वृत्तियों की नानाता से उसका भोग अनेक प्रकार का माना जाता है।

Though the thing the Lord has made — a gem, say — stands as one, its enjoyment is held to be manifold through the manifoldness of the enjoyers' mental movements.

हृष्यत्येको मणिं लब्ध्वा क्रुद्ध्यत्यन्योऽह्यलाभतः
पश्यत्येव विरक्तोऽत्र न हृष्यति न कुप्यति ॥ २१ ॥

hṛṣyatyeko maṇiṃ labdhvā kruddhyatyanyo'hyalābhataḥ
paśyatyeva virakto'tra na hṛṣyati na kupyati || 21 ||

Hrishyatyeko manim labdhvaa kruddhyatyanyo'hyalaabhatah pashyatyeva virakto'tra na hrishyati na kupyati

एक मणि पाकर हर्षित होता है, दूसरा न मिलने से क्रुद्ध होता है; और विरक्त यहाँ केवल देखता है — न हर्षित होता है न कुपित।

One is glad at getting the gem, another is angry at not getting it; the dispassionate man merely looks, and is neither glad nor angry.

प्रियोऽप्रिय उपेक्ष्यश्चेत्याकारा मणिगास्त्रयः
सृष्टा जीवैरीशसृष्टं रूपं साधारणं त्रिषु ॥ २२ ॥

priyo'priya upekṣyaścetyākārā maṇigāstrayaḥ
sṛṣṭā jīvairīśasṛṣṭaṃ rūpaṃ sādhāraṇaṃ triṣu || 22 ||

Priyo'priya upekshyashchetyaakaaraa manigaastrayah srishtaa jiivairiishasrishtam ruupam saadhaaranam trishu

प्रिय, अप्रिय और उपेक्षणीय — ये तीन आकार मणि में जीवों ने रचे हैं; ईश्वर का रचा हुआ रूप तो तीनों में एक ही है।

Dear, undesirable and to be passed over — these three forms in the gem are made by the souls; the form the Lord has made is common to all three.

भार्या स्नुषा ननान्दा च याता मातेत्यनेकधा
प्रतियोगिधिया योषिद्भिद्यते न स्वरूपतः ॥ २३ ॥

bhāryā snuṣā nanāndā ca yātā mātetyanekadhā
pratiyogidhiyā yoṣidbhidyate na svarūpataḥ || 23 ||

Bhaaryaa snushaa nanaandaa cha yaataa maatetyanekadhaa pratiyogidhiyaa yoshidbhidyate na svaruupatah

भार्या, पुत्रवधू, ननद, जेठानी, माता — इस प्रकार अनेक रूपों में प्रतियोगी की बुद्धि से स्त्री भिन्न होती है, स्वरूप से नहीं।

Wife, daughter-in-law, sister-in-law, husband's brother's wife, mother — in these many ways a woman differs by the thought of the one related to her, not in her own nature.

ननु ज्ञानानि भिद्यन्तामाकारस्तु न भिद्यते
योषिद्वपुष्यतिशयो न दृष्टो जीवनिर्मितः ॥ २४ ॥

nanu jñānāni bhidyantāmākārastu na bhidyate
yoṣidvapuṣyatiśayo na dṛṣṭo jīvanirmitaḥ || 24 ||

Nanu jnaanaani bhidyantaamaakaarastu na bhidyate yoshidvapushyatishayo na drishto jiivanirmitah

शङ्का: ज्ञान भले भिन्न हों, पर आकार तो भिन्न नहीं होता; स्त्री के शरीर में जीव का बनाया कोई अतिरिक्त अंश देखा नहीं जाता।

An objection: let the knowings differ, the form does not differ; no addition made by the individual is seen in a woman's body.

मैवं मांसमयी योषित्काचिदन्या मनोमयी
मांसमय्या अभेदेऽपि भिद्यते हि मनोमयी ॥ २५ ॥

maivaṃ māṃsamayī yoṣitkācidanyā manomayī
māṃsamayyā abhede'pi bhidyate hi manomayī || 25 ||

Maivam maamsamayii yoshitkaachidanyaa manomayii maamsamayyaa abhede'pi bhidyate hi manomayii

ऐसा नहीं; मांसमयी स्त्री कोई और है और मनोमयी कोई और; मांसमयी में भेद न होने पर भी मनोमयी में भेद होता ही है।

Not so; the woman made of flesh is one thing and the woman made of mind another; though there is no difference in the one of flesh, there is difference in the one of mind.

भ्रान्तिस्वप्नमनोराज्यस्मृतिष्वस्तु मनोमयम्
जाग्रन्मानेन मेयस्य न मनोमयतेति चेत् ॥ २६ ॥

bhrāntisvapnamanorājyasmṛtiṣvastu manomayam
jāgranmānena meyasya na manomayateti cet || 26 ||

Bhraantisvapnamanoraajyasmritishvastu manomayam jaagranmaanena meyasya na manomayateti chet

शङ्का: भ्रान्ति, स्वप्न, मनोराज्य और स्मृति में भले मनोमय हो; पर जाग्रत् में प्रमाण से जो मेय है वह मनोमय नहीं।

An objection: let what appears in error, dream, day-dream and memory be made of mind; but what is measured by a means of knowledge in waking is not made of mind.

बाढं माने तु मेयेन योगात्स्याद्विषयाकृतिः
भाष्यवार्तिककाराभ्यामयमर्थ उदीरितः ॥ २७ ॥

bāḍhaṃ māne tu meyena yogātsyādviṣayākṛtiḥ
bhāṣyavārtikakārābhyāmayamartha udīritaḥ || 27 ||

Baadham maane tu meyena yogaatsyaadvishayaakritih bhaashyavaartikakaaraabhyaamayamartha udiiritah

उत्तर: ठीक है; पर प्रमाण में मेय के योग से विषय का आकार बन जाता है — यही अर्थ भाष्यकार और वार्तिककार ने कहा है।

The answer: true; yet in the means of knowledge, by its union with the thing measured, the form of the object arises — this is what the commentator and the writer of the gloss have said.

मूषासिक्तं यथा ताम्रं तन्निभं जायते तथा
रूपादीन् व्याप्नुवच्चित्तं तन्निभं दृश्यते ध्रुवम् ॥ २८ ॥

mūṣāsiktaṃ yathā tāmraṃ tannibhaṃ jāyate tathā
rūpādīn vyāpnuvaccittaṃ tannibhaṃ dṛśyate dhruvam || 28 ||

Muushaasiktam yathaa taamram tannibham jaayate tathaa ruupaadiin vyaapnuvachchittam tannibham drishyate dhruvam

जैसे साँचे में ढाला हुआ ताँबा उसी के समान हो जाता है, वैसे ही रूप आदि को व्याप्त करता हुआ चित्त निश्चय ही उन्हीं के समान दिखाई देता है।

As copper poured into a mould takes its shape, so the mind, pervading form and the rest, is certainly seen to take their shape.

व्यंजको वा यथाऽलोको व्यंग्यस्याकारतामियात्
सर्वार्थव्यंजकत्वाद्धीरर्थाकारा प्रदृश्यते ॥ २९ ॥

vyaṃjako vā yathā'loko vyaṃgyasyākāratāmiyāt
sarvārthavyaṃjakatvāddhīrarthākārā pradṛśyate || 29 ||

Vyamjako vaa yathaa'loko vyamgyasyaakaarataamiyaat sarvaarthavyamjakatvaaddhiirarthaakaaraa pradrishyate

अथवा जैसे प्रकाश व्यङ्ग्य वस्तु का आकार ले लेता है, वैसे ही सब अर्थों को प्रकट करने वाली बुद्धि अर्थ के आकार वाली दिखाई देती है।

Or, as light takes on the shape of what it makes visible, so the understanding, which makes all things visible, is seen to have the shape of the thing.

मातुर्मानाभिनिष्पत्तिः निष्पन्नं मेयमेति तत्
मेयाभिसंगतं तच्च मेयाभत्वं प्रपद्यते ॥ ३० ॥

māturmānābhiniṣpattiḥ niṣpannaṃ meyameti tat
meyābhisaṃgataṃ tacca meyābhatvaṃ prapadyate || 30 ||

Maaturmaanaabhinishpattih nishpannam meyameti tat meyaabhisamgatam tachcha meyaabhatvam prapadyate

प्रमाता से प्रमाण की उत्पत्ति होती है; उत्पन्न हुआ प्रमाण मेय तक पहुँचता है; और मेय से संगत होकर वह मेय के आकार को प्राप्त होता है।

From the knower arises the means of knowledge; arisen, it reaches the thing to be known; and joined with it, it takes on the semblance of that thing.

सत्येवं विषयौ द्वौ स्तो घटौ मृण्मयधीमयौ
मृण्मयो मानमेयः स्यात्साक्षिभास्यस्तु धीमयः ॥ ३१ ॥

satyevaṃ viṣayau dvau sto ghaṭau mṛṇmayadhīmayau
mṛṇmayo mānameyaḥ syātsākṣibhāsyastu dhīmayaḥ || 31 ||

Satyevam vishayau dvau sto ghatau mrinmayadhiimayau mrinmayo maanameyah syaatsaakshibhaasyastu dhiimayah

ऐसा होने पर दो विषय बन जाते हैं — मिट्टी का घड़ा और बुद्धि का घड़ा। मिट्टी का घड़ा प्रमाण का मेय है, और बुद्धि का घड़ा साक्षी से भास्य है।

This being so, there are two objects — the pot of clay and the pot of thought. The pot of clay is what the means of knowledge measures; the pot of thought is lit by the witness.

अन्वयव्यतिरेकाभ्यां धीमयो जीवबंधकृत्
सत्यस्मिन् सुखदुःखे स्तस्तस्मिन्नसति न द्वयम् ॥ ३२ ॥

anvayavyatirekābhyāṃ dhīmayo jīvabaṃdhakṛt
satyasmin sukhaduḥkhe stastasminnasati na dvayam || 32 ||

Anvayavyatirekaabhyaam dhiimayo jiivabamdhakrit satyasmin sukhaduhkhe stastasminnasati na dvayam

अन्वय और व्यतिरेक से देखा जाए तो बुद्धि का घड़ा ही जीव को बाँधता है; उसके रहने पर सुख और दुःख होते हैं, उसके न रहने पर दोनों नहीं होते।

By presence and absence it is the pot of thought that binds the soul; when it is, pleasure and pain are, and when it is not, neither is.

असत्यपि च बाह्यार्थे स्वप्नादौ बध्यते नरः
समाधिसुप्तिमूर्छासु सत्यप्यस्मिन्न बध्यते ॥ ३३ ॥

asatyapi ca bāhyārthe svapnādau badhyate naraḥ
samādhisuptimūrchāsu satyapyasminna badhyate || 33 ||

Asatyapi cha baahyaarthe svapnaadau badhyate narah samaadhisuptimuurchhaasu satyapyasminna badhyate

बाहरी वस्तु के न होने पर भी स्वप्न आदि में मनुष्य बँधता है; और समाधि, सुषुप्ति तथा मूर्छा में उसके होने पर भी नहीं बँधता।

Even with no outward thing a man is bound in dream and the like; and in absorption, deep sleep and swoon he is not bound though the outward thing is there.

दूरदेशं गते पुत्रे जीवत्येवात्र तत्पिता
विप्रलंभकवाक्येन मृतं मत्वा प्ररोदिति ॥ ३४ ॥

dūradeśaṃ gate putre jīvatyevātra tatpitā
vipralaṃbhakavākyena mṛtaṃ matvā praroditi || 34 ||

Duuradesham gate putre jiivatyevaatra tatpitaa vipralambhakavaakyena mritam matvaa praroditi

पुत्र के दूर देश में चले जाने पर, वह वहाँ जीवित ही रहता है; पर ठगने वाले के वचन से उसे मरा हुआ मानकर पिता रोने लगता है।

When the son has gone to a far country he is alive there; yet on a deceiver's word the father takes him for dead and weeps.

मृतेऽपि तस्मिन् वार्तायामश्रुतायां न रोदिति
अतः सर्वस्य जीवस्य बंधकृन्मानसं जगत् ॥ ३५ ॥

mṛte'pi tasmin vārtāyāmaśrutāyāṃ na roditi
ataḥ sarvasya jīvasya baṃdhakṛnmānasaṃ jagat || 35 ||

Mrite'pi tasmin vaartaayaamashrutaayaam na roditi atah sarvasya jiivasya bamdhakrinmaanasam jagat

और उसके मर जाने पर भी, जब तक समाचार नहीं सुना, वह नहीं रोता। इससे जाना जाता है कि हर जीव को बाँधने वाला मानसिक जगत् ही है।

And when the son is really dead, so long as the news is not heard he does not weep. Hence it is the mental world that binds every soul.

विज्ञानवादो बाह्यार्थवैयर्थ्यात्स्यादिहेति चेत्
न हृद्याकारमाधातुं बाह्यस्यापेक्षितत्वतः ॥ ३६ ॥

vijñānavādo bāhyārthavaiyarthyātsyādiheti cet
na hṛdyākāramādhātuṃ bāhyasyāpekṣitatvataḥ || 36 ||

Vijnaanavaado baahyaarthavaiyarthyaatsyaadiheti chet na hridyaakaaramaadhaatum baahyasyaapekshitatvatah

यदि कहो कि इससे तो विज्ञानवाद आ जाएगा, क्योंकि बाह्य अर्थ व्यर्थ हो जाएगा — तो ऐसा नहीं, क्योंकि हृदय में आकार डालने के लिए बाह्य की अपेक्षा रहती ही है।

If you say that this brings in the doctrine of mere consciousness, since the outward thing becomes useless — not so, for an outward thing is still needed to set the form in the mind.

वैयर्थमस्तु वा बाह्यं न वारयितुमीश्महे
प्रयोजनमपेक्षन्ते न मानानीति हि स्थितिः ॥ ३७ ॥

vaiyarthamastu vā bāhyaṃ na vārayitumīśmahe
prayojanamapekṣante na mānānīti hi sthitiḥ || 37 ||

Vaiyarthamastu vaa baahyam na vaarayitumiishmahe prayojanamapekshante na maanaaniiti hi sthitih

अथवा बाह्य वस्तु व्यर्थ ही हो, हम उसे रोक नहीं सकते; क्योंकि प्रमाण प्रयोजन की अपेक्षा नहीं रखते — यही स्थिति है।

Or let the outward thing be useless, we cannot prevent it; for the settled rule is that means of knowledge do not wait upon a purpose.

बंधश्चेन्मानसद्वैतं तन्निरोधेन शाम्यति
अभ्यसेद्योगमेवातो ब्रह्मज्ञानेन किं वद ॥ ३८ ॥

baṃdhaścenmānasadvaitaṃ tannirodhena śāmyati
abhyasedyogamevāto brahmajñānena kiṃ vada || 38 ||

Bamdhashchenmaanasadvaitam tannirodhena shaamyati abhyasedyogamevaato brahmajnaanena kim vada

यदि मानस द्वैत ही बन्धन है, तो उसके निरोध से वह शान्त हो जाएगा; तो योग का ही अभ्यास करो — ब्रह्मज्ञान से क्या, बताओ?

If mental duality is the bondage, it will cease when that is restrained; then practise yoga alone — what need, say, of the knowledge of Brahman?

तात्कालिकद्वैतशांतावप्यागामिजनिक्षयः
ब्रह्मज्ञानं विना न स्यादिति वेदान्तडिंडिमः ॥ ३९ ॥

tātkālikadvaitaśāṃtāvapyāgāmijanikṣayaḥ
brahmajñānaṃ vinā na syāditi vedāntaḍiṃḍimaḥ || 39 ||

Taatkaalikadvaitashaamtaavapyaagaamijanikshayah brahmajnaanam vinaa na syaaditi vedaantadimdimah

तत्काल के लिए द्वैत शान्त हो जाने पर भी आगामी जन्मों का क्षय ब्रह्मज्ञान के बिना नहीं होता — यही वेदान्त का डिंडिम-घोष है।

Though duality is stilled for the time, the ending of births to come does not happen without the knowledge of Brahman — this is the drumbeat of Vedānta.

अनिवृत्तेऽपीशसृष्टे द्वैते तस्य मृषात्मताम्
बुद्ध्वा ब्रह्माद्वयं बोद्धुं शक्यं वस्त्वैक्यवादिनः ॥ ४० ॥

anivṛtte'pīśasṛṣṭe dvaite tasya mṛṣātmatām
buddhvā brahmādvayaṃ boddhuṃ śakyaṃ vastvaikyavādinaḥ || 40 ||

Anivritte'piishasrishte dvaite tasya mrishaatmataam buddhvaa brahmaadvayam boddhum shakyam vastvaikyavaadinah

ईश्वर-सृष्ट द्वैत के दूर न होने पर भी, उसके मिथ्यापन को जानकर, वस्तु की एकता मानने वाला अद्वय ब्रह्म को जान सकता है।

Even while the Lord's duality is not removed, one who holds to the oneness of the real can, knowing its falsity, know the non-dual Brahman.

प्रलये तन्निवृत्तौ तु गुरुशास्त्राद्यभावतः
विरोधिद्वैतभावेऽपि न शक्यं बोद्धुमद्वयम् ॥ ४१ ॥

pralaye tannivṛttau tu guruśāstrādyabhāvataḥ
virodhidvaitabhāve'pi na śakyaṃ boddhumadvayam || 41 ||

Pralaye tannivrittau tu gurushaastraadyabhaavatah virodhidvaitabhaave'pi na shakyam boddhumadvayam

पर प्रलय में उस द्वैत के निवृत्त हो जाने पर, गुरु और शास्त्र आदि के अभाव से, विरोधी द्वैत के न रहने पर भी अद्वय को जाना नहीं जा सकता।

But when in dissolution that duality has ceased, then, for want of teacher and scripture, the non-dual cannot be known, though the opposing duality is gone.

अबाधकं साधकं च द्वैतमीश्वरनिर्मितम्
अपनेतुमशक्यं चेत्यास्तां तद्द्विष्यते कुतः ॥ ४२ ॥

abādhakaṃ sādhakaṃ ca dvaitamīśvaranirmitam
apanetumaśakyaṃ cetyāstāṃ taddviṣyate kutaḥ || 42 ||

Abaadhakam saadhakam cha dvaitamiishvaranirmitam apanetumashakyam chetyaastaam taddvishyate kutah

ईश्वर का रचा द्वैत बाधक नहीं, साधक है, और उसे हटाया भी नहीं जा सकता; अतः वह रहे — उससे द्वेष क्यों किया जाए?

The Lord's duality does not hinder but helps, and it cannot be removed; so let it be — why should it be hated?

जीवद्वैतं तु शास्त्रीयमशास्त्रीयमिति द्विधा
उपाददीत शास्त्रीयमातत्त्वस्यावबोधनात् ॥ ४३ ॥

jīvadvaitaṃ tu śāstrīyamaśāstrīyamiti dvidhā
upādadīta śāstrīyamātattvasyāvabodhanāt || 43 ||

Jiivadvaitam tu shaastriiyamashaastriiyamiti dvidhaa upaadadiita shaastriiyamaatattvasyaavabodhanaat

जीव का द्वैत दो प्रकार का है — शास्त्रीय और अशास्त्रीय। शास्त्रीय को तत्त्व के बोध तक ग्रहण करना चाहिए।

The individual's duality is of two kinds, that which accords with scripture and that which does not. The first should be taken up until the truth is known.

आत्मब्रह्मविचाराख्यं शास्त्रीयं मानसं जगत्
बुद्धे तत्त्वे तच्च हेयमिति श्रुत्यनुशासनम् ॥ ४४ ॥

ātmabrahmavicārākhyaṃ śāstrīyaṃ mānasaṃ jagat
buddhe tattve tacca heyamiti śrutyanuśāsanam || 44 ||

Aatmabrahmavichaaraakhyam shaastriiyam maanasam jagat buddhe tattve tachcha heyamiti shrutyanushaasanam

आत्मा और ब्रह्म के विचार नाम वाला शास्त्रीय मानस जगत् है; तत्त्व जान लेने पर उसे भी छोड़ देना चाहिए — यही श्रुति का अनुशासन है।

The mental world that accords with scripture is the enquiry into Self and Brahman; when the truth is known that too is to be given up — such is the teaching of scripture.

शास्त्राण्यधीत्य मेधावी अभ्यस्य च पुनः पुनः
परमं ब्रह्म विज्ञाय उल्कावत्तान्यथोत्सृजेत् ॥ ४५ ॥

śāstrāṇyadhītya medhāvī abhyasya ca punaḥ punaḥ
paramaṃ brahma vijñāya ulkāvattānyathotsṛjet || 45 ||

Shaastraanyadhiitya medhaavii abhyasya cha punah punah paramam brahma vijnaaya ulkaavattaanyathotsrijet

'बुद्धिमान् शास्त्रों को पढ़कर, बार-बार अभ्यास करके, परम ब्रह्म को जानकर उन्हें उल्का की तरह छोड़ दे।'

'Let the wise man, having studied the scriptures and practised them again and again, and having known the supreme Brahman, cast them aside like a firebrand.'

ग्रन्थमभ्यस्य मेधावी ज्ञानविज्ञानतत्परः
पलालमिव धान्यार्थी त्यजेत् ग्रन्थमशेषतः ॥ ४६ ॥

granthamabhyasya medhāvī jñānavijñānatatparaḥ
palālamiva dhānyārthī tyajet granthamaśeṣataḥ || 46 ||

Granthamabhyasya medhaavii jnaanavijnaanatatparah palaalamiva dhaanyaarthii tyajet granthamasheshatah

'ज्ञान और विज्ञान में तत्पर बुद्धिमान् ग्रन्थ का अभ्यास करके, धान चाहने वाले के पुआल की तरह, ग्रन्थ को पूरी तरह छोड़ दे।'

'Let the wise man, intent on knowledge and realization, having practised the book, give up the book entirely, as one who wants the grain gives up the straw.'

तमेव धीरो विज्ञाय प्रज्ञां कुर्वीत ब्राह्मणः
नानुध्यायेद्बहून् शब्दान् वाचो विग्लापनं हि तत् ॥ ४७ ॥

tameva dhīro vijñāya prajñāṃ kurvīta brāhmaṇaḥ
nānudhyāyedbahūn śabdān vāco viglāpanaṃ hi tat || 47 ||

Tameva dhiiro vijnaaya prajnaam kurviita braahmanah naanudhyaayedbahuun shabdaan vaacho viglaapanam hi tat

'धीर ब्राह्मण उसी को जानकर प्रज्ञा करे; बहुत शब्दों का अनुध्यान न करे, क्योंकि वह वाणी का थकाना ही है।'

'Let the steadfast knower, having known Him alone, make wisdom his own; let him not brood over many words, for that is but the wearying of speech.'

तमेवैकं विजानीथ ह्यन्या वाचो विमुंचथ
यच्छेद्वाङ्मनसी प्राज्ञः इत्याद्याः श्रुतयः स्फुटाः ॥ ४८ ॥

tamevaikaṃ vijānītha hyanyā vāco vimuṃcatha
yacchedvāṅmanasī prājñaḥ ityādyāḥ śrutayaḥ sphuṭāḥ || 48 ||

Tamevaikam vijaaniitha hyanyaa vaacho vimumchatha yachchhedvaanmanasii praajnah ityaadyaah shrutayah sphutaah

'उसी एक को जानो, और दूसरी वाणियों को छोड़ दो'; 'प्राज्ञ वाणी को मन में समेटे' — ये और ऐसी श्रुतियाँ स्पष्ट हैं।

'Know Him alone and let go other words'; 'let the wise draw speech into mind' — these and such scriptures are plain.

अशास्त्रीयमपि द्वैतं तीव्रं मंदमिति द्विधा
कामक्रोधादिकं तीव्रं मनोराज्यं तथेतरत् ॥ ४९ ॥

aśāstrīyamapi dvaitaṃ tīvraṃ maṃdamiti dvidhā
kāmakrodhādikaṃ tīvraṃ manorājyaṃ tathetarat || 49 ||

Ashaastriiyamapi dvaitam tiivram mamdamiti dvidhaa kaamakrodhaadikam tiivram manoraajyam tathetarat

अशास्त्रीय द्वैत भी दो प्रकार का है — तीव्र और मन्द। काम, क्रोध आदि तीव्र हैं, और मनोराज्य मन्द।

The duality that does not accord with scripture is also of two kinds, sharp and mild. Desire, anger and the rest are sharp; day-dreaming is the other.

उभयं तत्त्वबोधात् प्राङ्निवार्यं बोधसिद्धये
शमः समाहितत्वं च साधनेषु श्रुतं यतः ॥ ५० ॥

ubhayaṃ tattvabodhāt prāṅnivāryaṃ bodhasiddhaye
śamaḥ samāhitatvaṃ ca sādhaneṣu śrutaṃ yataḥ || 50 ||

Ubhayam tattvabodhaat praannivaaryam bodhasiddhaye shamah samaahitatvam cha saadhaneshu shrutam yatah

तत्त्वबोध से पहले बोध की सिद्धि के लिए दोनों को हटाना चाहिए, क्योंकि साधनों में शम और समाहितपन सुने गए हैं।

Before the knowledge of truth both are to be kept off, so that knowledge may be won; for among the means, calm and collectedness are declared.

बोधादूर्ध्वं च तद्धेयं जीवन्मुक्तिप्रसिद्धये
कामादिक्लेशबंधेन युक्तस्य न हि मुक्तता ॥ ५१ ॥

bodhādūrdhvaṃ ca taddheyaṃ jīvanmuktiprasiddhaye
kāmādikleśabaṃdhena yuktasya na hi muktatā || 51 ||

Bodhaaduurdhvam cha taddheyam jiivanmuktiprasiddhaye kaamaadikleshabamdhena yuktasya na hi muktataa

और बोध के बाद भी जीवन्मुक्ति की सिद्धि के लिए उसे छोड़ना चाहिए; क्योंकि काम आदि क्लेशों के बन्धन से युक्त पुरुष मुक्त नहीं होता।

And after knowledge too it is to be given up, that freedom while living may be won; for one bound by the afflictions of desire and the rest is not free.

जीवन्मुक्तिरियं माभूज्जन्माभावे त्वहं कृती
तर्हि जन्माऽपि तेऽस्त्वेव स्वर्गमात्रात्कृती भवान् ॥ ५२ ॥

jīvanmuktiriyaṃ mābhūjjanmābhāve tvahaṃ kṛtī
tarhi janmā'pi te'stveva svargamātrātkṛtī bhavān || 52 ||

Jiivanmuktiriyam maabhuujjanmaabhaave tvaham kritii tarhi janmaa'pi te'stveva svargamaatraatkritii bhavaan

यदि कहो 'यह जीवन्मुक्ति न हो, जन्म न होने से ही मैं कृतार्थ हूँ' — तो तुम्हें जन्म भी हो ही; केवल स्वर्ग से ही तुम कृतार्थ हो जाओ।

If you say 'let there be no freedom while living; I am content that there be no rebirth' — then let rebirth also be yours, and be content with heaven alone.

क्षयातिशयदोषेण स्वर्गो हेयो यदा तदा
स्वयं दोषतमात्माऽयं कामादिः किं न हीयते ॥ ५३ ॥

kṣayātiśayadoṣeṇa svargo heyo yadā tadā
svayaṃ doṣatamātmā'yaṃ kāmādiḥ kiṃ na hīyate || 53 ||

Kshayaatishayadoshena svargo heyo yadaa tadaa svayam doshatamaatmaa'yam kaamaadih kim na hiiyate

जब क्षय और अतिशय के दोष से स्वर्ग त्याज्य है, तब स्वयं अत्यन्त दोषरूप ये काम आदि क्यों नहीं छोड़े जाते?

When heaven is to be given up because of the faults of ending and of inequality, why are desire and the rest, which are themselves the worst of faults, not given up?

तत्त्वं बुद्ध्वापि कामादीन्निःशेषं न जहासि चेत्
यथेष्टाचरणं ते स्यात् कर्मशास्त्रातिलंघिनः ॥ ५४ ॥

tattvaṃ buddhvāpi kāmādīnniḥśeṣaṃ na jahāsi cet
yatheṣṭācaraṇaṃ te syāt karmaśāstrātilaṃghinaḥ || 54 ||

Tattvam buddhvaapi kaamaadiinnihshesham na jahaasi chet yatheshtaacharanam te syaat karmashaastraatilamghinah

यदि तत्त्व जानकर भी तुम काम आदि को पूरी तरह नहीं छोड़ते, तो कर्मशास्त्र का उल्लङ्घन करने वाले तुम्हारा आचरण मनमाना हो जाएगा।

If, even knowing the truth, you do not wholly give up desire and the rest, your conduct will be as you please, and you will be one who oversteps the scriptures of action.

बुद्धाद्वैतस्वतत्त्वस्य यथेष्टाचरणं यदि
शुनां तत्त्वदृशां चैव को भेदोऽशुचिभक्षणे ॥ ५५ ॥

buddhādvaitasvatattvasya yatheṣṭācaraṇaṃ yadi
śunāṃ tattvadṛśāṃ caiva ko bhedo'śucibhakṣaṇe || 55 ||

Buddhaadvaitasvatattvasya yatheshtaacharanam yadi shunaam tattvadrishaam chaiva ko bhedo'shuchibhakshane

यदि अद्वैत-स्वरूप को जान लेने वाले का आचरण मनमाना हो, तो अपवित्र वस्तु खाने में कुत्तों और तत्त्वदर्शियों में क्या भेद रहेगा?

If one who has known the non-dual reality may act as he pleases, what difference is left between dogs and seers of truth in the eating of unclean things?

बोधात्पुरा मनोदोषमात्रात्क्लिश्यस्यथाधुना
अशेषलोकनिंदा चेत्यहो ते बोधवैभवम् ॥ ५६ ॥

bodhātpurā manodoṣamātrātkliśyasyathādhunā
aśeṣalokaniṃdā cetyaho te bodhavaibhavam || 56 ||

Bodhaatpuraa manodoshamaatraatklishyasyathaadhunaa asheshalokanimdaa chetyaho te bodhavaibhavam

बोध से पहले तुम केवल मन के दोष से क्लेश पाते थे; अब सारे लोक की निन्दा भी मिली — अहो, तुम्हारे बोध का वैभव!

Before knowledge you suffered only from the fault of the mind; now the censure of all the world is added too — what a glory your knowledge has!

विड्वराहादितुल्यत्वं मा कांक्षीस्तत्त्वविद्भवान्
सर्वधीदोषसंत्यागाल्लोकैः पूज्यश्च देववत् ॥ ५७ ॥

viḍvarāhāditulyatvaṃ mā kāṃkṣīstattvavidbhavān
sarvadhīdoṣasaṃtyāgāllokaiḥ pūjyaśca devavat || 57 ||

Vidvaraahaaditulyatvam maa kaamkshiistattvavidbhavaan sarvadhiidoshasamtyaagaallokaih puujyashcha devavat

तुम तत्त्ववेत्ता हो, सूअर आदि के समान होने की इच्छा मत करो; बुद्धि के सब दोषों को छोड़ देने से तुम देवता की तरह लोगों के पूज्य हो।

You are a knower of truth; do not wish to be like the swine. Giving up every fault of the mind, you are worshipped by men like a god.

काम्यादिदोषदृष्टयाद्याः कामादित्यागहेतवः
प्रसिद्धा मोक्षशास्त्रेषु तानन्विष्य सुखी भव ॥ ५८ ॥

kāmyādidoṣadṛṣṭayādyāḥ kāmādityāgahetavaḥ
prasiddhā mokṣaśāstreṣu tānanviṣya sukhī bhava || 58 ||

Kaamyaadidoshadrishtayaadyaah kaamaadityaagahetavah prasiddhaa mokshashaastreshu taananvishya sukhii bhava

काम्य वस्तुओं में दोष देखना आदि काम आदि के त्याग के उपाय मोक्षशास्त्रों में प्रसिद्ध हैं; उन्हें खोजकर सुखी हो।

Seeing the fault in what is desired, and such means of giving up desire and the rest, are well known in the scriptures of liberation; seek them out and be happy.

त्यज्यतामेष कामादिर्मनोराज्ये तु का क्षतिः
अशेषदोषबीजत्वात् क्षतिर्भगवतेरिता ॥ ५९ ॥

tyajyatāmeṣa kāmādirmanorājye tu kā kṣatiḥ
aśeṣadoṣabījatvāt kṣatirbhagavateritā || 59 ||

Tyajyataamesha kaamaadirmanoraajye tu kaa kshatih asheshadoshabiijatvaat kshatirbhagavateritaa

ये काम आदि छोड़े जाएँ; पर मनोराज्य में क्या हानि है? — हानि यह है कि वह समस्त दोषों का बीज है, ऐसा भगवान् ने कहा है।

Let desire and the rest be given up; but what harm is there in day-dreaming? The harm is that it is the seed of every fault, as the Lord has said.

ध्यायतो विषयान् पुंसः संगस्तेषूपजायते
संगात्संजायते कामः कामात्क्रोधोऽभिजायते ॥ ६० ॥

dhyāyato viṣayān puṃsaḥ saṃgasteṣūpajāyate
saṃgātsaṃjāyate kāmaḥ kāmātkrodho'bhijāyate || 60 ||

Dhyaayato vishayaan pumsah samgasteshuupajaayate samgaatsamjaayate kaamah kaamaatkrodho'bhijaayate

'विषयों का ध्यान करते हुए पुरुष की उनमें आसक्ति उत्पन्न होती है; आसक्ति से काम उत्पन्न होता है, और काम से क्रोध उत्पन्न होता है।'

'In a man who broods on objects attachment to them is born; from attachment desire is born, and from desire anger arises.'

शक्यं जेतुं मनोराज्यं निर्विकल्पसमाधितः
सुसंपादः क्रमात्सोपि सविकल्पसमाधिना ॥ ६१ ॥

śakyaṃ jetuṃ manorājyaṃ nirvikalpasamādhitaḥ
susaṃpādaḥ kramātsopi savikalpasamādhinā || 61 ||

Shakyam jetum manoraajyam nirvikalpasamaadhitah susampaadah kramaatsopi savikalpasamaadhinaa

निर्विकल्प समाधि से मनोराज्य को जीता जा सकता है; और वह समाधि भी सविकल्प समाधि से क्रमशः सहज ही सिद्ध हो जाती है।

Day-dreaming can be conquered by distinctionless absorption; and that absorption too is easily won, step by step, through absorption with distinctions.

बुद्धतत्त्वेन धीदोषशून्येनैकान्तवासिना
दीर्घं प्रणवमुच्चार्य मनोराज्यं विजीयते ॥ ६२ ॥

buddhatattvena dhīdoṣaśūnyenaikāntavāsinā
dīrghaṃ praṇavamuccārya manorājyaṃ vijīyate || 62 ||

Buddhatattvena dhiidoshashuunyenaikaantavaasinaa diirgham pranavamuchchaarya manoraajyam vijiiyate

जिसने तत्त्व जान लिया है, जिसकी बुद्धि दोष से रहित है और जो एकान्त में रहता है, वह दीर्घ प्रणव का उच्चारण करके मनोराज्य को जीत लेता है।

One who has known the truth, whose mind is free of fault and who dwells alone, conquers day-dreaming by sounding the long praṇava.

जिते तस्मिन् वृत्तिशून्यं मनस्तिष्ठति मूकवत्
एतत्पदं वसिष्ठेन रामाय बहुधेरितम् ॥ ६३ ॥

jite tasmin vṛttiśūnyaṃ manastiṣṭhati mūkavat
etatpadaṃ vasiṣṭhena rāmāya bahudheritam || 63 ||

Jite tasmin vrittishuunyam manastishthati muukavat etatpadam vasishthena raamaaya bahudheritam

उसके जीत लिए जाने पर मन वृत्ति से रहित होकर गूँगे की तरह ठहरा रहता है; इस पद को वसिष्ठ ने राम से अनेक प्रकार से कहा है।

When it is conquered the mind stands without movement, like one dumb; this state Vasiṣṭha set out to Rāma in many ways.

दृश्यं नास्तीति बोधेन मनसो दृश्यमार्जनम्
संपन्नं चेत्तदुत्पन्ना परा निर्वाणनिर्वृतिः ॥ ६४ ॥

dṛśyaṃ nāstīti bodhena manaso dṛśyamārjanam
saṃpannaṃ cettadutpannā parā nirvāṇanirvṛtiḥ || 64 ||

Drishyam naastiiti bodhena manaso drishyamaarjanam sampannam chettadutpannaa paraa nirvaananirvritih

'दृश्य है ही नहीं' — इस बोध से यदि मन से दृश्य का मार्जन हो जाए, तो परम निर्वाण की शान्ति उत्पन्न होती है।

If by the knowledge 'the seen is not' the seen is wiped from the mind, then the highest peace of extinction arises.

विचारितमलं शास्त्रं चिरमुद्ग्राहितं मिथः
संत्यक्तवासनान्मौनादृते नास्त्युत्तमं परम् ॥ ६५ ॥

vicāritamalaṃ śāstraṃ ciramudgrāhitaṃ mithaḥ
saṃtyaktavāsanānmaunādṛte nāstyuttamaṃ param || 65 ||

Vichaaritamalam shaastram chiramudgraahitam mithah samtyaktavaasanaanmaunaadrite naastyuttamam param

शास्त्र का बहुत विचार किया गया, चिरकाल तक परस्पर ग्रहण कराया गया; पर वासनाओं के त्याग से युक्त मौन से बढ़कर कोई उत्तम पद नहीं है।

Scripture has been thought over enough and long taught to one another; yet there is no higher state than the silence that comes of giving up all latent tendencies.

विक्षिप्यते कदाचिद्धीः कर्मणा भोगदायिना
पुनः समाहिता सा स्यात्तथैवाभ्यासपाटवात् ॥ ६६ ॥

vikṣipyate kadāciddhīḥ karmaṇā bhogadāyinā
punaḥ samāhitā sā syāttathaivābhyāsapāṭavāt || 66 ||

Vikshipyate kadaachiddhiih karmanaa bhogadaayinaa punah samaahitaa saa syaattathaivaabhyaasapaatavaat

भोग देने वाले कर्म से बुद्धि कभी विक्षिप्त हो जाती है; पर अभ्यास की कुशलता से वह उसी प्रकार फिर समाहित हो जाती है।

Sometimes the mind is scattered by a deed that brings enjoyment; but by skill in practice it becomes gathered again in the same way.

विक्षेपो यस्य नास्त्यस्य ब्रह्मवित्त्वं न मन्यते
ब्रह्मैवायमिति प्राहुर्मुनयः पारदर्शिनः ॥ ६७ ॥

vikṣepo yasya nāstyasya brahmavittvaṃ na manyate
brahmaivāyamiti prāhurmunayaḥ pāradarśinaḥ || 67 ||

Vikshepo yasya naastyasya brahmavittvam na manyate brahmaivaayamiti praahurmunayah paaradarshinah

जिसे विक्षेप नहीं होता, उसे केवल ब्रह्मवेत्ता नहीं माना जाता; पार देखने वाले मुनि कहते हैं कि 'यह ब्रह्म ही है'।

He who has no distraction is not regarded as merely a knower of Brahman; the sages who see beyond say, 'this man is Brahman itself'.

दर्शनादर्शने हित्वा स्वयं केवलरूपतः
यस्तिष्ठति स तु ब्रह्मन् ब्रह्म न ब्रह्मवित्स्वयम् ॥ ६८ ॥

darśanādarśane hitvā svayaṃ kevalarūpataḥ
yastiṣṭhati sa tu brahman brahma na brahmavitsvayam || 68 ||

Darshanaadarshane hitvaa svayam kevalaruupatah yastishthati sa tu brahman brahma na brahmavitsvayam

जो देखना और न देखना — दोनों को छोड़कर स्वयं केवल-रूप से स्थित रहता है, हे ब्राह्मण, वह ब्रह्म ही है, ब्रह्म को जानने वाला मात्र नहीं।

He who, giving up both seeing and not seeing, stands of himself in his own aloneness — he, O Brāhmaṇa, is Brahman, not merely a knower of Brahman.

जीवन्मुक्तेः पराकाष्ठा जीवद्वैतविवर्जनात्
लभ्यतेऽसावतोऽत्रेदमीशद्वैताद्विवेचितम् ॥ ६९ ॥

jīvanmukteḥ parākāṣṭhā jīvadvaitavivarjanāt
labhyate'sāvato'tredamīśadvaitādvivecitam || 69 ||

Jiivanmukteh paraakaashthaa jiivadvaitavivarjanaat labhyate'saavato'tredamiishadvaitaadvivechitam

जीव के द्वैत को छोड़ देने से ही जीवन्मुक्ति की परम काष्ठा प्राप्त होती है; इसीलिए यहाँ इसे ईश्वर के द्वैत से अलग करके दिखाया गया।

The highest point of freedom while living is reached only by giving up the individual's duality; and that is why it has here been distinguished from the Lord's duality.

येनेक्षते शृणोतीदं जिघ्रति व्याकरोति च
स्वाद्वस्वादू विजानाति तत्प्रज्ञानमुदीरितम् ॥ १ ॥

yenekṣate śṛṇotīdaṃ jighrati vyākaroti ca
svādvasvādū vijānāti tatprajñānamudīritam || 1 ||

Yenekshate shrinotiidam jighrati vyaakaroti cha svaadvasvaaduu vijaanaati tatprajnaanamudiiritam

'जिससे मनुष्य यह देखता है, सुनता है, सूँघता है, बोलता है, और स्वादु-अस्वादु को जानता है — वह प्रज्ञान कहा गया है।'

'That by which a man sees this, hears, smells, speaks, and knows the tasty from the tasteless — that is declared to be consciousness.'

चतुर्मुखेंद्रदेवेषु मनुष्याश्वगवादिषु
चैतन्यमेकं ब्रह्मातः प्रज्ञानं ब्रह्म मय्यपि ॥ २ ॥

caturmukheṃdradeveṣu manuṣyāśvagavādiṣu
caitanyamekaṃ brahmātaḥ prajñānaṃ brahma mayyapi || 2 ||

Chaturmukhemdradeveshu manushyaashvagavaadishu chaitanyamekam brahmaatah prajnaanam brahma mayyapi

चतुर्मुख ब्रह्मा, इन्द्र और देवताओं में, तथा मनुष्य, घोड़े, गौ आदि में चैतन्य एक ही है; अतः 'प्रज्ञान ब्रह्म है' और मुझमें भी वही है।

In four-faced Brahmā, in Indra and the gods, and in men, horses, cattle and the rest, awareness is one; therefore 'consciousness is Brahman', and it is in me as well.

परिपूर्णः परात्माऽस्मिन् देहे विद्याधिकारिणि
बुद्धेः साक्षितया स्थित्वा स्फुरन्नहमितीर्यते ॥ ३ ॥

paripūrṇaḥ parātmā'smin dehe vidyādhikāriṇi
buddheḥ sākṣitayā sthitvā sphurannahamitīryate || 3 ||

Paripuurnah paraatmaa'smin dehe vidyaadhikaarini buddheh saakshitayaa sthitvaa sphurannahamitiiryate

परिपूर्ण परमात्मा विद्या के अधिकारी इस देह में बुद्धि का साक्षी होकर स्थित है, और 'अहम्' के रूप में स्फुरित होता हुआ कहा जाता है।

The all-full supreme Self abides in this body, fit for knowledge, as the witness of the understanding, and shining forth is spoken of as 'I'.

स्वतः पूर्णः परात्माऽत्र ब्रह्मशब्देन वर्णितः
अस्मीत्यैक्यपरामर्शस्तेन ब्रह्म भवाम्यहम् ॥ ४ ॥

svataḥ pūrṇaḥ parātmā'tra brahmaśabdena varṇitaḥ
asmītyaikyaparāmarśastena brahma bhavāmyaham || 4 ||

Svatah puurnah paraatmaa'tra brahmashabdena varnitah asmiityaikyaparaamarshastena brahma bhavaamyaham

स्वतः पूर्ण परमात्मा यहाँ 'ब्रह्म' शब्द से कहा गया है; 'अस्मि' से एकता का परामर्श होता है, और इसलिए 'मैं ब्रह्म हूँ'।

The supreme Self, full of itself, is here named by the word 'Brahman'; by 'am' the oneness is referred to, and so 'I am Brahman'.

एकमेवाद्वितीयं सन्नामरूपविवर्जितम्
सृष्टेः पुराऽधुनाप्यस्य तादृक्त्वं तदितीर्यते ॥ ५ ॥

ekamevādvitīyaṃ sannāmarūpavivarjitam
sṛṣṭeḥ purā'dhunāpyasya tādṛktvaṃ taditīryate || 5 ||

Ekamevaadvitiiyam sannaamaruupavivarjitam srishteh puraa'dhunaapyasya taadriktvam taditiiryate

सृष्टि से पहले और अब भी यह एक ही, अद्वितीय, नाम-रूप से रहित सत् है; उसका वैसा ही होना 'तत्' पद से कहा जाता है।

Before creation and now as well, this is being, one only, without a second, free of name and form; its being such is what the word 'That' declares.

श्रोतुर्देहेन्द्रियातीतं वस्त्वत्र त्वंपदेरितम्
एकता गृह्यतेऽसीति तदैक्यमनुभूयताम् ॥ ६ ॥

śroturdehendriyātītaṃ vastvatra tvaṃpaderitam
ekatā gṛhyate'sīti tadaikyamanubhūyatām || 6 ||

Shroturdehendriyaatiitam vastvatra tvampaderitam ekataa grihyate'siiti tadaikyamanubhuuyataam

श्रोता के देह और इन्द्रियों से परे जो वस्तु है, वह यहाँ 'त्वम्' पद से कही गई है; 'असि' से एकता ग्रहण की जाती है — उस एकता का अनुभव करो।

The reality beyond the hearer's body and organs is here declared by the word 'thou'; by 'art' the oneness is taken up — let that oneness be experienced.

स्वप्रकाशापरोक्षत्वमयमित्युक्तितो मतम्
अहंकारादिदेहान्तात्प्रत्यगात्मेति गीयते ॥ ७ ॥

svaprakāśāparokṣatvamayamityuktito matam
ahaṃkārādidehāntātpratyagātmeti gīyate || 7 ||

Svaprakaashaaparokshatvamayamityuktito matam ahamkaaraadidehaantaatpratyagaatmeti giiyate

'अयम्' के कहने से स्वयंप्रकाश और अपरोक्ष होना माना जाता है; अहंकार से लेकर देह तक से भिन्न होने पर वह 'प्रत्यगात्मा' कहा जाता है।

By the word 'this' its being self-luminous and directly present is meant; as other than all from the I-sense down to the body it is called the inward Self.

दृश्यमानस्य सर्वस्य जगतस्तत्वमीर्यते
ब्रह्मशब्देन तद्ब्रह्म स्वप्रकाशात्मरूपकम् ॥ ८ ॥

dṛśyamānasya sarvasya jagatastatvamīryate
brahmaśabdena tadbrahma svaprakāśātmarūpakam || 8 ||

Drishyamaanasya sarvasya jagatastatvamiiryate brahmashabdena tadbrahma svaprakaashaatmaruupakam

जो कुछ दिखाई देता है, उस सारे जगत् का तत्त्व 'ब्रह्म' शब्द से कहा जाता है; वह ब्रह्म स्वयंप्रकाश आत्मा ही है।

The reality of all this visible world is declared by the word 'Brahman'; and that Brahman is the self-luminous Self itself.

यथा चित्रपटे दृष्टमवस्थानां चतुष्टयम्
परमात्मनि विज्ञेयं तथाऽवस्थाचतुष्टयम् ॥ १ ॥

yathā citrapaṭe dṛṣṭamavasthānāṃ catuṣṭayam
paramātmani vijñeyaṃ tathā'vasthācatuṣṭayam || 1 ||

Yathaa chitrapate drishtamavasthaanaam chatushtayam paramaatmani vijneyam tathaa'vasthaachatushtayam

जैसे चित्र के पट में चार अवस्थाएँ देखी जाती हैं, वैसे ही परमात्मा में भी चार अवस्थाएँ जाननी चाहिए।

As four conditions are seen in a painted cloth, so four conditions are to be known in the supreme Self.

यथा धौतो घट्टितश्च लांछितो रंजितः पटः
चिदन्तर्यामी सूत्रात्मा विराडात्मा तथेर्यते ॥ २ ॥

yathā dhauto ghaṭṭitaśca lāṃchito raṃjitaḥ paṭaḥ
cidantaryāmī sūtrātmā virāḍātmā tatheryate || 2 ||

Yathaa dhauto ghattitashcha laamchhito ramjitah patah chidantaryaamii suutraatmaa viraadaatmaa tatheryate

जैसे पट धुला हुआ, कलफ़ किया हुआ, रेखाओं से अङ्कित और रंगा हुआ होता है, वैसे ही चित्, अन्तर्यामी, सूत्रात्मा और विराडात्मा कहे जाते हैं।

As the cloth is washed, stiffened, marked with outlines and filled with colour, so are spoken of pure awareness, the inner ruler, the thread-Self and the cosmic Self.

स्वतः शुभ्रोऽत्र धौतः स्याद्घट्टितोऽन्नविलेपनात्
मष्याकारैर्लाञ्छितः स्याद्रञ्जितो वर्णपूरणात् ॥ ३ ॥

svataḥ śubhro'tra dhautaḥ syādghaṭṭito'nnavilepanāt
maṣyākārairlāñchitaḥ syādrañjito varṇapūraṇāt || 3 ||

Svatah shubhro'tra dhautah syaadghattito'nnavilepanaat mashyaakaarairlaanchhitah syaadranjito varnapuuranaat

यहाँ स्वतः श्वेत होना 'धुला हुआ' है; अन्न के लेप से 'कलफ़ किया हुआ'; स्याही की रेखाओं से 'अङ्कित'; और रंग भरने से 'रंगा हुआ'।

Here its being white of itself is the washing; the coat of starch is the stiffening; the ink outlines are the marking; and the filling in of colour is the dyeing.

स्वतश्चिदन्तर्यामी तु मायावी सूक्ष्मसृष्टितः
सूत्रात्मा स्थूलसृष्ट्यैव विराडित्युच्यते परः ॥ ४ ॥

svataścidantaryāmī tu māyāvī sūkṣmasṛṣṭitaḥ
sūtrātmā sthūlasṛṣṭyaiva virāḍityucyate paraḥ || 4 ||

Svatashchidantaryaamii tu maayaavii suukshmasrishtitah suutraatmaa sthuulasrishtyaiva viraadityuchyate parah

स्वतः चित् है; मायावी होने से अन्तर्यामी; सूक्ष्म सृष्टि से सूत्रात्मा; और स्थूल सृष्टि से ही वही पर 'विराट्' कहा जाता है।

Of itself it is awareness; as wielder of illusion it is the inner ruler; by the subtle creation it is the thread-Self; and by the gross creation that same supreme is called the cosmic person.

ब्रह्माद्यास्तंबपर्यन्ताः प्राणिनोऽत्र जडा अपि
उत्तमाधमभावेन वर्तन्ते पटचित्रवत् ॥ ५ ॥

brahmādyāstaṃbaparyantāḥ prāṇino'tra jaḍā api
uttamādhamabhāvena vartante paṭacitravat || 5 ||

Brahmaadyaastambaparyantaah praanino'tra jadaa api uttamaadhamabhaavena vartante patachitravat

ब्रह्मा से लेकर तृण तक के प्राणी, और जड़ वस्तुएँ भी, यहाँ उत्तम और अधम भाव से रहते हैं — पट के चित्र की तरह।

From Brahmā down to a tuft of grass, living beings and insentient things too stand here as higher and lower, like the figures in a painted cloth.

चित्रार्पितमनुष्याणां वस्त्राभासाः पृथक् पृथक्
चित्राधारेण वस्त्रेण सदृशा इव कल्पिताः ॥ ६ ॥

citrārpitamanuṣyāṇāṃ vastrābhāsāḥ pṛthak pṛthak
citrādhāreṇa vastreṇa sadṛśā iva kalpitāḥ || 6 ||

Chitraarpitamanushyaanaam vastraabhaasaah prithak prithak chitraadhaarena vastrena sadrishaa iva kalpitaah

चित्र में बने मनुष्यों के वस्त्रों की आभाएँ अलग-अलग हैं; वे चित्र के आधारभूत वस्त्र के समान-सी ही कल्पित की जाती हैं।

The semblances of clothing on the men in the picture are each separate; they are imagined as though like the cloth that bears the picture.

पृथक् पृथक् चिदाभासाश्चैतन्याध्यस्तदेहिनाम्
कल्प्यन्ते जीवनामानो बहुधा संसरन्त्यमी ॥ ७ ॥

pṛthak pṛthak cidābhāsāścaitanyādhyastadehinām
kalpyante jīvanāmāno bahudhā saṃsarantyamī || 7 ||

Prithak prithak chidaabhaasaashchaitanyaadhyastadehinaam kalpyante jiivanaamaano bahudhaa samsarantyamii

चैतन्य पर अध्यस्त देहधारियों की अलग-अलग चिदाभासें 'जीव' नाम से कल्पित की जाती हैं; ये ही अनेक प्रकार से संसार में भटकते हैं।

The separate reflections of awareness in the embodied beings superimposed upon awareness are imagined under the name of souls; these it is that wander in many ways through the world.

वस्त्राभासस्थितान् वर्णान् यद्वदाधारवस्त्रगान्
वदन्त्यज्ञास्तथा जीवसंसारं चिद्गतं विदुः ॥ ८ ॥

vastrābhāsasthitān varṇān yadvadādhāravastragān
vadantyajñāstathā jīvasaṃsāraṃ cidgataṃ viduḥ || 8 ||

Vastraabhaasasthitaan varnaan yadvadaadhaaravastragaan vadantyajnaastathaa jiivasamsaaram chidgatam viduh

जैसे अज्ञानी वस्त्र की आभा पर पड़े रंगों को आधारभूत वस्त्र का ही कहते हैं, वैसे ही जीव के संसार को वे चित् का समझ लेते हैं।

As the ignorant call the colours that lie on the semblance of clothing colours of the underlying cloth, so they take the soul's round of birth and death to belong to awareness.

चित्रस्थपर्वतादीनां वस्त्राभासो न लिख्यते
सृष्टिस्थमृत्तिकादीनां चिदाभासस्तथा न हि ॥ ९ ॥

citrasthaparvatādīnāṃ vastrābhāso na likhyate
sṛṣṭisthamṛttikādīnāṃ cidābhāsastathā na hi || 9 ||

Chitrasthaparvataadiinaam vastraabhaaso na likhyate srishtisthamrittikaadiinaam chidaabhaasastathaa na hi

चित्र में बने पर्वत आदि के लिए वस्त्र की आभा नहीं लिखी जाती; वैसे ही सृष्टि में स्थित मिट्टी आदि के लिए चिदाभास नहीं होता।

For the mountains and the rest in the picture no semblance of clothing is drawn; so for the clay and the rest in creation there is no reflection of awareness.

संसारः परमार्थोऽयं संलग्नः स्वात्मवस्तुनि
इति भ्रान्तिरविद्या स्याद्विद्ययैषा निवर्तते ॥ १० ॥

saṃsāraḥ paramārtho'yaṃ saṃlagnaḥ svātmavastuni
iti bhrāntiravidyā syādvidyayaiṣā nivartate || 10 ||

Samsaarah paramaartho'yam samlagnah svaatmavastuni iti bhraantiravidyaa syaadvidyayaishaa nivartate

'यह संसार परमार्थ है और मेरी आत्म-वस्तु से लगा हुआ है' — यह भ्रान्ति ही अविद्या है, और विद्या से यह दूर होती है।

'This round of birth and death is real and clings to my own Self' — this error is nescience, and by knowledge it is removed.

आत्माभासस्य जीवस्य संसारो नात्मवस्तुनः
इति बोधो भवेद्विद्यया लभ्यतेऽसौ विचारणात् ॥ ११ ॥

ātmābhāsasya jīvasya saṃsāro nātmavastunaḥ
iti bodho bhavedvidyayā labhyate'sau vicāraṇāt || 11 ||

Aatmaabhaasasya jiivasya samsaaro naatmavastunah iti bodho bhavedvidyayaa labhyate'sau vichaaranaat

'संसार आत्माभास-रूप जीव का है, आत्म-वस्तु का नहीं' — यह बोध विद्या से होता है, और वह विचार से प्राप्त होती है।

'The round of birth and death belongs to the soul, which is the reflection of the Self, not to the Self itself' — this knowledge comes by wisdom, and that is got by enquiry.

सदा विचारयेत्तस्माज्जगज्जीवपरात्मनः
जीवभावजगद्भावबाधे स्वात्मैव शिष्यते ॥ १२ ॥

sadā vicārayettasmājjagajjīvaparātmanaḥ
jīvabhāvajagadbhāvabādhe svātmaiva śiṣyate || 12 ||

Sadaa vichaarayettasmaajjagajjiivaparaatmanah jiivabhaavajagadbhaavabaadhe svaatmaiva shishyate

इसलिए जगत्, जीव और परमात्मा का सदा विचार करना चाहिए; जीव-भाव और जगत्-भाव के बाधित हो जाने पर अपना आत्मा ही शेष रहता है।

Therefore one should always enquire into the world, the soul and the supreme Self; when the notions of soul and of world are set aside, one's own Self alone remains.

नाप्रतीतिस्तयोर्बाधः किं तु मिथ्यास्वनिश्चयः
नो चेत्सुषुप्तिमूर्छादौ मुच्येतायत्नतो जनः ॥ १३ ॥

nāpratītistayorbādhaḥ kiṃ tu mithyāsvaniścayaḥ
no cetsuṣuptimūrchādau mucyetāyatnato janaḥ || 13 ||

Naapratiitistayorbaadhah kim tu mithyaasvanishchayah no chetsushuptimuurchhaadau muchyetaayatnato janah

उन दोनों का बाध केवल न दिखना नहीं है, बल्कि उनके मिथ्या होने का निश्चय है; अन्यथा सुषुप्ति और मूर्छा में ही मनुष्य बिना प्रयत्न के मुक्त हो जाता।

Their setting-aside is not their mere non-appearance but the certainty that they are false; otherwise a man would be freed without effort in deep sleep and in swoon.

परमात्मावशेषोऽपि तत्सत्यत्वविनिश्चयः
न जगद्विस्मृतिर्नो चेज्जीवन्मुक्तिर्न संभवेत् ॥ १४ ॥

paramātmāvaśeṣo'pi tatsatyatvaviniścayaḥ
na jagadvismṛtirno cejjīvanmuktirna saṃbhavet || 14 ||

Paramaatmaavashesho'pi tatsatyatvavinishchayah na jagadvismritirno chejjiivanmuktirna sambhavet

परमात्मा का शेष रहना भी उसके सत्यत्व का निश्चय है, जगत् का भूल जाना नहीं; अन्यथा जीवन्मुक्ति सम्भव ही न होती।

The remaining over of the supreme Self, too, is the certainty of its reality, not a forgetting of the world; otherwise freedom while living would be impossible.

परोक्षा चापरोक्षेति विद्या द्वेधा विचारजा
तत्रापरोक्षविद्याप्तौ विचारोऽयं समाप्यते ॥ १५ ॥

parokṣā cāparokṣeti vidyā dvedhā vicārajā
tatrāparokṣavidyāptau vicāro'yaṃ samāpyate || 15 ||

Parokshaa chaaparoksheti vidyaa dvedhaa vichaarajaa tatraaparokshavidyaaptau vichaaro'yam samaapyate

विचार से उत्पन्न विद्या दो प्रकार की है — परोक्ष और अपरोक्ष; उनमें अपरोक्ष विद्या के प्राप्त होने पर यह विचार समाप्त हो जाता है।

The knowledge born of enquiry is of two kinds, indirect and direct; and when the direct is won, this enquiry comes to an end.

अस्ति ब्रह्मेति चेद्वेद परोक्षज्ञानमेव तत्
अहं ब्रह्मेति चेद्वेद साक्षात्कारस्स उच्यते ॥ १६ ॥

asti brahmeti cedveda parokṣajñānameva tat
ahaṃ brahmeti cedveda sākṣātkārassa ucyate || 16 ||

Asti brahmeti chedveda parokshajnaanameva tat aham brahmeti chedveda saakshaatkaarassa uchyate

यदि कोई जाने 'ब्रह्म है' — तो वह परोक्ष ज्ञान ही है; और यदि जाने 'मैं ब्रह्म हूँ' — तो वह साक्षात्कार कहलाता है।

If one knows 'Brahman is', that is indirect knowledge; if one knows 'I am Brahman', that is called direct realization.

तत्साक्षात्कारसिद्ध्यर्थमात्मतत्त्वं विविच्यते
येनायं सर्वसंसारात्सद्य एव विमुच्यते ॥ १७ ॥

tatsākṣātkārasiddhyarthamātmatattvaṃ vivicyate
yenāyaṃ sarvasaṃsārātsadya eva vimucyate || 17 ||

Tatsaakshaatkaarasiddhyarthamaatmatattvam vivichyate yenaayam sarvasamsaaraatsadya eva vimuchyate

उस साक्षात्कार की सिद्धि के लिए आत्म-तत्त्व का विवेचन किया जाता है, जिससे यह पुरुष सारे संसार से तत्काल ही मुक्त हो जाता है।

To win that realization the truth of the Self is sifted out, by which this man is freed from the whole round of birth and death at once.

कूटस्थो ब्रह्म जीवेशावित्येवं चिच्चतुर्विधा
घटाकाशमहाकाशौ जलाकाशाभ्रखे यथा ॥ १८ ॥

kūṭastho brahma jīveśāvityevaṃ ciccaturvidhā
ghaṭākāśamahākāśau jalākāśābhrakhe yathā || 18 ||

Kuutastho brahma jiiveshaavityevam chichchaturvidhaa ghataakaashamahaakaashau jalaakaashaabhrakhe yathaa

कूटस्थ, ब्रह्म, जीव और ईश्वर — इस प्रकार चित् चार प्रकार की है, जैसे घटाकाश, महाकाश, जलाकाश और मेघाकाश।

The unchanging, Brahman, the soul and the Lord — thus awareness is of four kinds, as space in a pot, the great space, space in water, and space in cloud.

घटावच्छिन्नखे नीरं यत्तत्र प्रतिबिंबितः
साभ्रनक्षत्र आकाशो जलाकाश उदीरितः ॥ १९ ॥

ghaṭāvacchinnakhe nīraṃ yattatra pratibiṃbitaḥ
sābhranakṣatra ākāśo jalākāśa udīritaḥ || 19 ||

Ghataavachchhinnakhe niiram yattatra pratibimbitah saabhranakshatra aakaasho jalaakaasha udiiritah

घड़े से घिरे आकाश में जो जल है, उसमें प्रतिबिम्बित बादलों और नक्षत्रों वाला आकाश 'जलाकाश' कहा गया है।

The sky with its clouds and stars, reflected in the water held within the space enclosed by the pot, is called the space in water.

महाकाशस्य मध्ये यन्मेघमंडलमीक्ष्यते
प्रतिबिंबतया तत्र मेघाकाशो जले स्थितः ॥ २० ॥

mahākāśasya madhye yanmeghamaṃḍalamīkṣyate
pratibiṃbatayā tatra meghākāśo jale sthitaḥ || 20 ||

Mahaakaashasya madhye yanmeghamamdalamiikshyate pratibimbatayaa tatra meghaakaasho jale sthitah

महाकाश के मध्य में जो मेघमण्डल दिखाई देता है, उसके जल में प्रतिबिम्ब-रूप से स्थित जो आकाश है, वही 'मेघाकाश' है।

In the mass of cloud seen in the midst of the great space, the space present as a reflection in its water — that is the space in cloud.

मेघांशरूपमुदकं तुषाराकारसंस्थितम्
तत्र खप्रतिबिंबोऽयं नीरत्वादनुमीयते ॥ २१ ॥

meghāṃśarūpamudakaṃ tuṣārākārasaṃsthitam
tatra khapratibiṃbo'yaṃ nīratvādanumīyate || 21 ||

Meghaamsharuupamudakam tushaaraakaarasamsthitam tatra khapratibimbo'yam niiratvaadanumiiyate

मेघ के अंश-रूप जल तुषार के आकार में ठहरा हुआ है; उसमें यह आकाश का प्रतिबिम्ब जलत्व के कारण अनुमान से जाना जाता है।

The water that is a portion of the cloud stands in the form of mist; in it this reflection of the sky is inferred because it is water.

अधिष्ठानतया देहद्वयावच्छिन्नचेतनः
कूटवन्निर्विकारेण स्थितः कूटस्थ उच्यते ॥ २२ ॥

adhiṣṭhānatayā dehadvayāvacchinnacetanaḥ
kūṭavannirvikāreṇa sthitaḥ kūṭastha ucyate || 22 ||

Adhishthaanatayaa dehadvayaavachchhinnachetanah kuutavannirvikaarena sthitah kuutastha uchyate

अधिष्ठान-रूप से दोनों देहों से अवच्छिन्न चैतन्य, निहाई की तरह निर्विकार होकर स्थित रहने से 'कूटस्थ' कहलाता है।

The awareness bounded by the two bodies as their ground, standing changeless like an anvil, is called the unchanging one.

कूटस्थे कल्पिता बुद्धिस्तत्र चित्प्रतिबिंबकः
प्राणानां धारणाज्जीवस्संसारेण स युज्यते ॥ २३ ॥

kūṭasthe kalpitā buddhistatra citpratibiṃbakaḥ
prāṇānāṃ dhāraṇājjīvassaṃsāreṇa sa yujyate || 23 ||

Kuutasthe kalpitaa buddhistatra chitpratibimbakah praanaanaam dhaaranaajjiivassamsaarena sa yujyate

कूटस्थ में बुद्धि कल्पित है, और उसमें चित् का प्रतिबिम्ब पड़ता है; प्राणों को धारण करने से वही जीव है, और वही संसार से युक्त होता है।

In the unchanging one the understanding is imagined, and in that falls the reflection of awareness; holding the breaths, it is the soul, and it is joined to the round of birth and death.

जलव्योम्ना घटाकाशो यथा सर्वस्तिरोहितः
तथा जीवेन कूटस्थः सोऽन्योन्याध्यास उच्यते ॥ २४ ॥

jalavyomnā ghaṭākāśo yathā sarvastirohitaḥ
tathā jīvena kūṭasthaḥ so'nyonyādhyāsa ucyate || 24 ||

Jalavyomnaa ghataakaasho yathaa sarvastirohitah tathaa jiivena kuutasthah so'nyonyaadhyaasa uchyate

जैसे जल के आकाश से घटाकाश पूरी तरह ढँक जाता है, वैसे ही जीव से कूटस्थ ढँक जाता है; इसी को अन्योन्याध्यास कहते हैं।

As the space in the pot is wholly hidden by the space in the water, so the unchanging one is hidden by the soul; this is called mutual superimposition.

अयं जीवो न कूटस्थं विविनक्ति कदाचन
अनादिरविवेकोऽयं मूलाविद्येति गम्यताम् ॥ २५ ॥

ayaṃ jīvo na kūṭasthaṃ vivinakti kadācana
anādiraviveko'yaṃ mūlāvidyeti gamyatām || 25 ||

Ayam jiivo na kuutastham vivinakti kadaachana anaadiraviveko'yam muulaavidyeti gamyataam

यह जीव कूटस्थ को कभी अलग नहीं कर पाता; यह अनादि अविवेक ही 'मूलाविद्या' है — ऐसा समझना चाहिए।

This soul never distinguishes the unchanging one; this beginningless want of discernment is to be understood as the root nescience.

विक्षेपावृतिरूपाभ्यां द्विधाऽविद्या व्यवस्थिता
न भाति नास्ति कूटस्थ इत्यापादनमावृतिः ॥ २६ ॥

vikṣepāvṛtirūpābhyāṃ dvidhā'vidyā vyavasthitā
na bhāti nāsti kūṭastha ityāpādanamāvṛtiḥ || 26 ||

Vikshepaavritiruupaabhyaam dvidhaa'vidyaa vyavasthitaa na bhaati naasti kuutastha ityaapaadanamaavritih

अविद्या विक्षेप और आवरण — दो रूपों में स्थित है; 'कूटस्थ भासता नहीं, है ही नहीं' — ऐसा प्रतीत कराना आवरण है।

Nescience stands in two forms, projection and covering; to bring it about that 'the unchanging one does not shine, is not' is the covering.

अज्ञानी विदुषा पृष्टः कूटस्थं न प्रबुध्यते
न भाति नास्ति कूटस्थ इति बुध्वा वदत्यपि ॥ २७ ॥

ajñānī viduṣā pṛṣṭaḥ kūṭasthaṃ na prabudhyate
na bhāti nāsti kūṭastha iti budhvā vadatyapi || 27 ||

Ajnaanii vidushaa prishtah kuutastham na prabudhyate na bhaati naasti kuutastha iti budhvaa vadatyapi

अज्ञानी विद्वान् के पूछने पर कूटस्थ को नहीं समझ पाता; और 'कूटस्थ भासता नहीं, है ही नहीं' — ऐसा समझकर यही कहता भी है।

The ignorant man, asked by one who knows, does not awake to the unchanging one; and, thinking 'the unchanging one does not shine, is not', he even says so.

स्वप्रकाशे कुतोऽविद्या तां विना कथमावृतिः
इत्यादितर्कजालानि स्वानुभूतिर्ग्रसत्यसौ ॥ २८ ॥

svaprakāśe kuto'vidyā tāṃ vinā kathamāvṛtiḥ
ityāditarkajālāni svānubhūtirgrasatyasau || 28 ||

Svaprakaashe kuto'vidyaa taam vinaa kathamaavritih ityaaditarkajaalaani svaanubhuutirgrasatyasau

'स्वयंप्रकाश में अविद्या कहाँ से? और उसके बिना आवरण कैसे?' — ऐसे तर्कों के जाल को यह स्व-अनुभूति निगल जाती है।

'How can there be nescience in the self-luminous, and how a covering without it?' — this self-experience swallows up such nets of argument.

स्वानुभूतावविश्वासे तर्कस्याप्यनवस्थितेः
कथं वा तार्किकंमन्यस्तत्त्वनिश्चयमाप्नुयात् ॥ २९ ॥

svānubhūtāvaviśvāse tarkasyāpyanavasthiteḥ
kathaṃ vā tārkikaṃmanyastattvaniścayamāpnuyāt || 29 ||

Svaanubhuutaavavishvaase tarkasyaapyanavasthiteh katham vaa taarkikammanyastattvanishchayamaapnuyaat

स्व-अनुभूति में अविश्वास हो और तर्क की भी कोई स्थिति न हो, तो अपने को तार्किक मानने वाला तत्त्व का निश्चय कैसे पाएगा?

If there is no trust in self-experience, and argument too has no fixity, how shall one who thinks himself a reasoner reach certainty about the truth?

बुद्ध्यारोहाय तर्कश्चेदपेक्षेत तथा सति
स्वानुभूत्यनुसारेण तर्क्यतां मा कुतर्क्यताम् ॥ ३० ॥

buddhyārohāya tarkaścedapekṣeta tathā sati
svānubhūtyanusāreṇa tarkyatāṃ mā kutarkyatām || 30 ||

Buddhyaarohaaya tarkashchedapeksheta tathaa sati svaanubhuutyanusaarena tarkyataam maa kutarkyataam

यदि बुद्धि में बैठाने के लिए तर्क अपेक्षित हो, तो ऐसा होने पर स्व-अनुभूति के अनुसार तर्क करो, कुतर्क मत करो।

If argument is needed to settle a thing in the mind, then in that case argue in accordance with self-experience, and do not argue perversely.

स्वानुभूतिरविद्यायामावृतौ च प्रदर्शिता
अतः कूटस्थचैतन्यमविरोधीति तर्क्यताम् ॥ ३१ ॥

svānubhūtiravidyāyāmāvṛtau ca pradarśitā
ataḥ kūṭasthacaitanyamavirodhīti tarkyatām || 31 ||

Svaanubhuutiravidyaayaamaavritau cha pradarshitaa atah kuutasthachaitanyamavirodhiiti tarkyataam

अविद्या और आवरण में भी स्व-अनुभूति दिखाई गई है; इसलिए कूटस्थ चैतन्य इनका विरोधी नहीं है — ऐसा ही तर्क करना चाहिए।

Self-experience has been shown even in nescience and in the covering; so it should be argued that the unchanging awareness is not opposed to them.

तच्चेद्विरोधि केनेयमावृतिर्ह्यनुभूयताम्
विवेकस्तु विरोध्यस्यास्तत्त्वज्ञानिनि दृश्यताम् ॥ ३२ ॥

taccedvirodhi keneyamāvṛtirhyanubhūyatām
vivekastu virodhyasyāstattvajñānini dṛśyatām || 32 ||

Tachchedvirodhi keneyamaavritirhyanubhuuyataam vivekastu virodhyasyaastattvajnaanini drishyataam

यदि वह (चैतन्य) इसका विरोधी हो, तो यह आवरण किसके द्वारा अनुभूत हो? विरोध तो विवेक का है — वह तत्त्वज्ञानी में देखा जाए।

If awareness were opposed to it, by whom would this covering be experienced? What is opposed to it is discernment, and that is to be seen in the knower of truth.

अविद्यावृतकूटस्थे देहद्वययुता चितिः
शुक्तौ रूप्यवदध्यस्ता विक्षेपाध्यास एव हि ॥ ३३ ॥

avidyāvṛtakūṭasthe dehadvayayutā citiḥ
śuktau rūpyavadadhyastā vikṣepādhyāsa eva hi || 33 ||

Avidyaavritakuutasthe dehadvayayutaa chitih shuktau ruupyavadadhyastaa vikshepaadhyaasa eva hi

अविद्या से ढँके हुए कूटस्थ में दोनों देहों से युक्त चित् वैसे ही अध्यस्त है जैसे सीप में चाँदी; यही विक्षेप-अध्यास है।

On the unchanging one, covered by nescience, awareness joined with the two bodies is superimposed as silver is on mother-of-pearl; this is the superimposition of projection.

इदमंशस्य सत्यत्वं शुक्तिगं रूप्य ईक्ष्यते
स्वयंत्वं वस्तुताचैवं विक्षेपे वीक्ष्यतेऽन्यगम् ॥ ३४ ॥

idamaṃśasya satyatvaṃ śuktigaṃ rūpya īkṣyate
svayaṃtvaṃ vastutācaivaṃ vikṣepe vīkṣyate'nyagam || 34 ||

Idamamshasya satyatvam shuktigam ruupya iikshyate svayamtvam vastutaachaivam vikshepe viikshyate'nyagam

सीप में चाँदी के भ्रम में 'इदम्' अंश की सत्यता देखी जाती है; वैसे ही विक्षेप में 'स्वयम्' और वस्तुता दूसरी जगह से आई हुई दिखाई देती है।

In the silver on the mother-of-pearl the reality of the 'this' portion is seen; so in projection the 'self' and the reality are seen as coming from elsewhere.

नीलपृष्ठत्रिकोणत्वं यथा शुक्तौ तिरोहितम्
असंगानन्दताद्येवं कूटस्थेऽपि तिरोहितम् ॥ ३५ ॥

nīlapṛṣṭhatrikoṇatvaṃ yathā śuktau tirohitam
asaṃgānandatādyevaṃ kūṭasthe'pi tirohitam || 35 ||

Niilaprishthatrikonatvam yathaa shuktau tirohitam asamgaanandataadyevam kuutasthe'pi tirohitam

जैसे सीप में उसका नीला पृष्ठ और त्रिकोणपन ढँक जाता है, वैसे ही कूटस्थ में असङ्गता और आनन्दरूपता आदि ढँक जाते हैं।

As in the mother-of-pearl its blue back and its triangular shape are hidden, so in the unchanging one its unattachedness and its blissfulness are hidden.

आरोपितस्य दृष्टान्ते रूप्यं नाम यथा तथा
कूटस्थाध्यस्तविक्षेपनामाऽहमिति निश्चयः ॥ ३६ ॥

āropitasya dṛṣṭānte rūpyaṃ nāma yathā tathā
kūṭasthādhyastavikṣepanāmā'hamiti niścayaḥ || 36 ||

Aaropitasya drishtaante ruupyam naama yathaa tathaa kuutasthaadhyastavikshepanaamaa'hamiti nishchayah

दृष्टान्त में आरोपित वस्तु का नाम जैसे 'चाँदी' है, वैसे ही कूटस्थ पर अध्यस्त विक्षेप का नाम 'अहम्' यह निश्चय है।

As in the example the name of what is superimposed is 'silver', so the name of the projection superimposed on the unchanging one is the conviction 'I'.

इदमंशं स्वतः पश्यन् रूप्यमित्यभिमन्यते
तथा स्वं च स्वतः पश्यन्नहमित्यभिमन्यते ॥ ३७ ॥

idamaṃśaṃ svataḥ paśyan rūpyamityabhimanyate
tathā svaṃ ca svataḥ paśyannahamityabhimanyate || 37 ||

Idamamsham svatah pashyan ruupyamityabhimanyate tathaa svam cha svatah pashyannahamityabhimanyate

'इदम्' अंश को स्वतः देखता हुआ मनुष्य उसे 'चाँदी' मान लेता है; वैसे ही 'स्वयम्' को स्वतः देखता हुआ उसे 'अहम्' मान लेता है।

Seeing the 'this' portion of itself, a man takes it for silver; so, seeing the 'self' of itself, he takes it for 'I'.

इदन्त्वरूप्यते भिन्ने स्वत्वाहन्ते तथेष्यताम्
सामान्यं च विशेषश्च ह्युभयत्रापि गम्यते ॥ ३८ ॥

idantvarūpyate bhinne svatvāhante tatheṣyatām
sāmānyaṃ ca viśeṣaśca hyubhayatrāpi gamyate || 38 ||

Idantvaruupyate bhinne svatvaahante tatheshyataam saamaanyam cha visheshashcha hyubhayatraapi gamyate

'इदन्ता' और 'रूप्यता' भिन्न हैं; वैसे ही 'स्वत्व' और 'अहन्ता' को भी भिन्न मानो। दोनों जगह सामान्य और विशेष — दोनों जाने जाते हैं।

'This-ness' and 'silver-ness' are different; so let 'self-ness' and 'I-ness' be held different too. In both cases the general and the particular are understood.

देवदत्तः स्वयं गच्छेत्त्वं वीक्षस्व स्वयं तथा
अहं स्वयं न शक्नोमीत्येवं लोके प्रयुज्यते ॥ ३९ ॥

devadattaḥ svayaṃ gacchettvaṃ vīkṣasva svayaṃ tathā
ahaṃ svayaṃ na śaknomītyevaṃ loke prayujyate || 39 ||

Devadattah svayam gachchhettvam viikshasva svayam tathaa aham svayam na shaknomiityevam loke prayujyate

'देवदत्त स्वयं जाए', 'तू स्वयं देख', 'मैं स्वयं नहीं कर सकता' — लोक में इस प्रकार 'स्वयम्' का प्रयोग होता है।

'Let Devadatta go himself', 'see for yourself', 'I myself cannot' — in this way the word 'self' is used in the world.

इदं रूप्यमिदं वस्त्रमिति यद्वदिदं तथा
असौ त्वमहमित्येषु स्वयमित्यभिमन्यते ॥ ४० ॥

idaṃ rūpyamidaṃ vastramiti yadvadidaṃ tathā
asau tvamahamityeṣu svayamityabhimanyate || 40 ||

Idam ruupyamidam vastramiti yadvadidam tathaa asau tvamahamityeshu svayamityabhimanyate

'यह चाँदी है', 'यह वस्त्र है' — जैसे यहाँ 'इदम्' है, वैसे ही 'वह', 'तू', 'मैं' — इन सबमें 'स्वयम्' माना जाता है।

'This is silver', 'this is cloth' — as 'this' runs through these, so 'self' is understood in 'he', 'thou' and 'I'.

अहन्त्वाद्भिद्यतां स्वत्वं कूटस्थे तेन किं तव
स्वयंशब्दार्थ एवैष कूटस्थ इति मे भवेत् ॥ ४१ ॥

ahantvādbhidyatāṃ svatvaṃ kūṭasthe tena kiṃ tava
svayaṃśabdārtha evaiṣa kūṭastha iti me bhavet || 41 ||

Ahantvaadbhidyataam svatvam kuutasthe tena kim tava svayamshabdaartha evaisha kuutastha iti me bhavet

यदि 'स्वत्व' अहन्ता से भिन्न होकर कूटस्थ में हो, तो तुम्हारा क्या बिगड़ा? मेरे लिए तो 'स्वयम्' शब्द का अर्थ कूटस्थ ही हो जाएगा।

If 'self-ness', being other than 'I-ness', belongs to the unchanging one, what is that to you? For me the meaning of the word 'self' will then be just the unchanging one.

अन्यत्ववारकं स्वत्वमिति चेदन्यवारणम्
कूटस्थस्यात्मतां वक्तुरिष्टमेव हि तद्भवेत् ॥ ४२ ॥

anyatvavārakaṃ svatvamiti cedanyavāraṇam
kūṭasthasyātmatāṃ vakturiṣṭameva hi tadbhavet || 42 ||

Anyatvavaarakam svatvamiti chedanyavaaranam kuutasthasyaatmataam vakturishtameva hi tadbhavet

यदि कहो कि 'स्वत्व' अन्यत्व का वारक है — तो अन्य का वारण करना ही कूटस्थ की आत्मता कहने वाले का अभीष्ट है।

If you say that 'self-ness' wards off otherness, then that warding off of the other is just what is wanted by one who calls the unchanging one the Self.

स्वयमात्मेति पर्यायौ तेन लोके तयोस्सह
प्रयोगो नास्त्यतः स्वत्वमात्मत्वं चान्यवारकम् ॥ ४३ ॥

svayamātmeti paryāyau tena loke tayossaha
prayogo nāstyataḥ svatvamātmatvaṃ cānyavārakam || 43 ||

Svayamaatmeti paryaayau tena loke tayossaha prayogo naastyatah svatvamaatmatvam chaanyavaarakam

'स्वयम्' और 'आत्मा' पर्यायवाची हैं; इसीलिए लोक में दोनों का एक साथ प्रयोग नहीं होता। अतः स्वत्व और आत्मत्व — दोनों अन्य के वारक हैं।

'Self' and 'ātman' are words of one meaning; that is why the world does not use both together. So self-ness and Self-hood both ward off the other.

घटः स्वयं न जानातीत्येवं स्वत्वं घटादिषु
अचेतनेषु दृष्टं चेद्दृश्यतामात्मसत्वतः ॥ ४४ ॥

ghaṭaḥ svayaṃ na jānātītyevaṃ svatvaṃ ghaṭādiṣu
acetaneṣu dṛṣṭaṃ ceddṛśyatāmātmasatvataḥ || 44 ||

Ghatah svayam na jaanaatiityevam svatvam ghataadishu achetaneshu drishtam cheddrishyataamaatmasatvatah

'घड़ा स्वयं नहीं जानता' — इस प्रकार घड़े आदि अचेतनों में भी स्वत्व देखा जाता है, यदि कहो — तो वह आत्मा के सत्त्व के कारण ही देखा जाता है।

'The pot does not know of itself' — if you say that self-ness is thus seen in insentient things like pots, then let it be seen as due to the presence of the Self.

चेतनाचेतनभिदा कूटस्थात्मकृता न हि
किं तु बुद्धिकृताभासकृतैवेत्यवगम्यताम् ॥ ४५ ॥

cetanācetanabhidā kūṭasthātmakṛtā na hi
kiṃ tu buddhikṛtābhāsakṛtaivetyavagamyatām || 45 ||

Chetanaachetanabhidaa kuutasthaatmakritaa na hi kim tu buddhikritaabhaasakritaivetyavagamyataam

चेतन और अचेतन का भेद कूटस्थ आत्मा से नहीं किया गया; बल्कि बुद्धि और आभास से ही किया गया है — ऐसा समझना चाहिए।

The division into sentient and insentient is not made by the unchanging Self; it is made by the understanding and by the reflection — so it is to be understood.

यथा चेतन आभासः कूटस्थे भ्रान्तिकल्पितः
अचेतनो घटादिश्च तथा तत्त्रैव कल्पितः ॥ ४६ ॥

yathā cetana ābhāsaḥ kūṭasthe bhrāntikalpitaḥ
acetano ghaṭādiśca tathā tattraiva kalpitaḥ || 46 ||

Yathaa chetana aabhaasah kuutasthe bhraantikalpitah achetano ghataadishcha tathaa tattraiva kalpitah

जैसे चेतन आभास कूटस्थ में भ्रान्ति से कल्पित है, वैसे ही अचेतन घट आदि भी वहीं कल्पित हैं।

As the sentient reflection is imagined on the unchanging one through error, so the insentient pot and the rest are imagined there too.

तत्तेदन्ते अपि स्वत्वमिव त्वमहमादिषु
सर्वत्रानुगते तेन तयोरप्यात्मतेति चेत् ॥ ४७ ॥

tattedante api svatvamiva tvamahamādiṣu
sarvatrānugate tena tayorapyātmateti cet || 47 ||

Tattedante api svatvamiva tvamahamaadishu sarvatraanugate tena tayorapyaatmateti chet

यदि कहो कि 'तत्ता' और 'इदन्ता' भी 'स्वत्व' की तरह 'तू', 'मैं' आदि सबमें अनुगत हैं, इसलिए उनकी भी आत्मता है —

If you say that 'that-ness' and 'this-ness' too, like 'self-ness', run through 'thou', 'I' and the rest, and are therefore the Self —

ते आत्मत्वेऽप्यनुगते तत्त्वेदन्ते ततस्तयोः
आत्मत्वम् नैव संभाव्यं सम्यक्तवादेर्यथा तथा ॥ ४८ ॥

te ātmatve'pyanugate tattvedante tatastayoḥ
ātmatvam naiva saṃbhāvyaṃ samyaktavāderyathā tathā || 48 ||

Te aatmatve'pyanugate tattvedante tatastayoh aatmatvam naiva sambhaavyam samyaktavaaderyathaa tathaa

— तो 'तत्ता' और 'इदन्ता' आत्मत्व में भी अनुगत हैं; अतः उनकी आत्मता सम्भव ही नहीं — जैसे 'सम्यक्त्व' आदि की नहीं होती।

— then 'that-ness' and 'this-ness' run through Self-hood as well; so their being the Self is not possible at all, any more than rightness and such are.

तत्तेदन्ते स्वताऽन्यत्वे त्वन्ताहन्ते परस्परम्
प्रतिद्वंद्वितया लोके प्रसिद्धे नास्ति संशयः ॥ ४९ ॥

tattedante svatā'nyatve tvantāhante parasparam
pratidvaṃdvitayā loke prasiddhe nāsti saṃśayaḥ || 49 ||

Tattedante svataa'nyatve tvantaahante parasparam pratidvamdvitayaa loke prasiddhe naasti samshayah

'तत्ता' और 'इदन्ता', 'स्वता' और 'अन्यता', 'त्वन्ता' और 'अहन्ता' — ये लोक में परस्पर प्रतिद्वन्द्वी रूप में प्रसिद्ध हैं; इसमें कोई सन्देह नहीं।

'That-ness' and 'this-ness', 'self-ness' and 'otherness', 'thou-ness' and 'I-ness' are well known in the world as each other's counterparts; of this there is no doubt.

अन्यतायाः प्रतिद्वंद्वी स्वयं कूटस्थ इष्यताम्
त्वन्तायाः प्रतियोग्येषोऽहमित्यात्मनि कल्पितः ॥ ५० ॥

anyatāyāḥ pratidvaṃdvī svayaṃ kūṭastha iṣyatām
tvantāyāḥ pratiyogyeṣo'hamityātmani kalpitaḥ || 50 ||

Anyataayaah pratidvamdvii svayam kuutastha ishyataam tvantaayaah pratiyogyesho'hamityaatmani kalpitah

अन्यता का प्रतिद्वन्द्वी 'स्वयम्' — अर्थात् कूटस्थ — माना जाए; और 'त्वन्ता' का प्रतियोगी यह 'अहम्' है, जो आत्मा में कल्पित है।

Let the counterpart of otherness be 'self', that is, the unchanging one; and the counterpart of 'thou-ness' is this 'I', which is imagined in the Self.

अहन्तास्वत्वयोर्भेदे रूप्यतेदन्तयोरिव
स्पष्टेऽपि मोहमापन्ना एकत्वं प्रतिपेदिरे ॥ ५१ ॥

ahantāsvatvayorbhede rūpyatedantayoriva
spaṣṭe'pi mohamāpannā ekatvaṃ pratipedire || 51 ||

Ahantaasvatvayorbhede ruupyatedantayoriva spashte'pi mohamaapannaa ekatvam pratipedire

जैसे चाँदी और 'इदन्ता' का भेद स्पष्ट है, वैसे ही अहन्ता और स्वत्व का भेद स्पष्ट होने पर भी लोग मोह में पड़कर उनकी एकता मान बैठे।

Though the difference between 'I-ness' and 'self-ness' is as plain as that between silver and 'this-ness', men fall into delusion and take them to be one.

तादात्म्याध्यास एवात्र पूर्वोक्ताविद्यया कृतः
अविद्यायां निवृत्तायां तत्कार्यं विनिवर्तते ॥ ५२ ॥

tādātmyādhyāsa evātra pūrvoktāvidyayā kṛtaḥ
avidyāyāṃ nivṛttāyāṃ tatkāryaṃ vinivartate || 52 ||

Taadaatmyaadhyaasa evaatra puurvoktaavidyayaa kritah avidyaayaam nivrittaayaam tatkaaryam vinivartate

यहाँ यही तादात्म्य-अध्यास है, जो पहले कही हुई अविद्या से किया गया है; अविद्या के निवृत्त होने पर उसका कार्य भी निवृत्त हो जाता है।

This here is the superimposition of identity, made by the nescience spoken of before; when nescience ceases, its work ceases too.

अविद्यावृतितादात्म्ये विद्ययैव विनश्यतः
विक्षेपस्य स्वरूपं तु प्रारब्धक्षयमीक्षते ॥ ५३ ॥

avidyāvṛtitādātmye vidyayaiva vinaśyataḥ
vikṣepasya svarūpaṃ tu prārabdhakṣayamīkṣate || 53 ||

Avidyaavrititaadaatmye vidyayaiva vinashyatah vikshepasya svaruupam tu praarabdhakshayamiikshate

अविद्या का आवरण और तादात्म्य विद्या से ही नष्ट होते हैं; किन्तु विक्षेप का स्वरूप प्रारब्ध के क्षय की प्रतीक्षा करता है।

The covering of nescience and the identification are destroyed by knowledge alone; but the projection in its own form waits for the wearing out of the deeds already begun.

उपादाने विनष्टेऽपि क्षणं कार्यं प्रतीक्षते
इत्याहुस्तार्किकास्तद्वदस्माकं किं न संभवेत् ॥ ५४ ॥

upādāne vinaṣṭe'pi kṣaṇaṃ kāryaṃ pratīkṣate
ityāhustārkikāstadvadasmākaṃ kiṃ na saṃbhavet || 54 ||

Upaadaane vinashte'pi kshanam kaaryam pratiikshate ityaahustaarkikaastadvadasmaakam kim na sambhavet

उपादान के नष्ट हो जाने पर भी कार्य एक क्षण ठहरता है — ऐसा तार्किक कहते हैं; वैसा ही हमारे यहाँ क्यों न सम्भव हो?

The logicians say that even when the material cause is destroyed the effect lasts a moment; why should not the like be possible for us?

तंतूनां दिनसंख्यानां तैस्तादृक् क्षण ईरितः
भ्रमस्यासंख्यकल्पस्य योग्यः क्षण इहेष्यताम् ॥ ५५ ॥

taṃtūnāṃ dinasaṃkhyānāṃ taistādṛk kṣaṇa īritaḥ
bhramasyāsaṃkhyakalpasya yogyaḥ kṣaṇa iheṣyatām || 55 ||

Tamtuunaam dinasamkhyaanaam taistaadrik kshana iiritah bhramasyaasamkhyakalpasya yogyah kshana iheshyataam

जिन तन्तुओं की आयु कुछ दिनों की है, उनके लिए उन्होंने वैसा क्षण कहा; तो असंख्य कल्पों वाले भ्रम के लिए यहाँ उसके योग्य क्षण मान लेना चाहिए।

For threads whose life is counted in days they spoke of such a moment; then for an error that lasts countless world-ages let a moment of fitting length be granted here.

विना क्षोदक्षमं मानं तैर्वृथा परिकल्प्यते
श्रुतियुक्त्यनुभूतिभ्यो वदतां किं नु दुश्शकम् ॥ ५६ ॥

vinā kṣodakṣamaṃ mānaṃ tairvṛthā parikalpyate
śrutiyuktyanubhūtibhyo vadatāṃ kiṃ nu duśśakam || 56 ||

Vinaa kshodakshamam maanam tairvrithaa parikalpyate shrutiyuktyanubhuutibhyo vadataam kim nu dushshakam

परीक्षा में टिकने वाले प्रमाण के बिना वे व्यर्थ ही कल्पना करते हैं; श्रुति, युक्ति और अनुभूति से कहने वालों के लिए क्या कठिन है?

Without a proof that can stand examination they imagine in vain; but for those who speak from scripture, reasoning and experience, what is hard?

आस्तां दुस्तार्किकैस्साकं विवादं प्रकृतं ब्रुवे
स्वाहमोस्सिद्धमेकत्वं कूटस्थपरिणामिनोः ॥ ५७ ॥

āstāṃ dustārkikaissākaṃ vivādaṃ prakṛtaṃ bruve
svāhamossiddhamekatvaṃ kūṭasthapariṇāminoḥ || 57 ||

Aastaam dustaarkikaissaakam vivaadam prakritam bruve svaahamossiddhamekatvam kuutasthaparinaaminoh

कुतार्किकों के साथ विवाद रहने दो; प्रस्तुत विषय कहता हूँ — 'स्वयम्' और 'अहम्' की, अर्थात् कूटस्थ और परिणामी की, एकता सिद्ध हो चुकी।

Let the dispute with bad reasoners stand aside; I speak of the matter in hand — the oneness of 'self' and 'I', that is, of the unchanging and the changing, has been established.

भ्राम्यन्ते पंडितंमन्याः सर्वे लौकिकतैर्थिकाः
अनादृत्य श्रुतिं मौर्ख्यात्केवलं युक्तिमाश्रिताः ॥ ५८ ॥

bhrāmyante paṃḍitaṃmanyāḥ sarve laukikatairthikāḥ
anādṛtya śrutiṃ maurkhyātkevalaṃ yuktimāśritāḥ || 58 ||

Bhraamyante pamditammanyaah sarve laukikatairthikaah anaadritya shrutim maurkhyaatkevalam yuktimaashritaah

अपने को पण्डित मानने वाले सब लौकिक और तैर्थिक भ्रमते रहते हैं; मूर्खता से श्रुति का आदर न करके केवल युक्ति का आश्रय लेते हैं।

All the worldly and the sectarians who think themselves learned go astray; in their folly they pay no regard to scripture and lean on reasoning alone.

पूर्वापरपरामर्शविकलास्तत्र केचन
वाक्याभासान् स्वस्वपक्षे योजयन्त्यप्यलज्जया ॥ ५९ ॥

pūrvāparaparāmarśavikalāstatra kecana
vākyābhāsān svasvapakṣe yojayantyapyalajjayā || 59 ||

Puurvaaparaparaamarshavikalaastatra kechana vaakyaabhaasaan svasvapakshe yojayantyapyalajjayaa

उनमें कुछ लोग पूर्वापर का विचार न करके, वाक्यों के आभास को निर्लज्जता से अपने-अपने पक्ष में जोड़ देते हैं।

Some among them, without looking to what goes before and after, shamelessly fit mere semblances of texts to their own positions.

कूटस्थादिशरीरान्तसंघातस्यात्मतां जगुः
लोकायताः पामराश्च प्रत्यक्षाभासमाश्रिताः ॥ ६० ॥

kūṭasthādiśarīrāntasaṃghātasyātmatāṃ jaguḥ
lokāyatāḥ pāmarāśca pratyakṣābhāsamāśritāḥ || 60 ||

Kuutasthaadishariiraantasamghaatasyaatmataam jaguh lokaayataah paamaraashcha pratyakshaabhaasamaashritaah

कूटस्थ से लेकर शरीर तक के संघात को ही आत्मा कहते हैं — ऐसा लोकायत और साधारण जन कहते हैं, जो प्रत्यक्षाभास का आश्रय लेते हैं।

The materialists and the common people, leaning on a semblance of perception, call the aggregate from the unchanging one down to the body the Self.

श्रौतीकर्तुं स्वपक्षं ते कोशमन्नमयं तथा
विरोचनस्य सिद्धान्तं प्रमाणं प्रतिजज्ञिरे ॥ ६१ ॥

śrautīkartuṃ svapakṣaṃ te kośamannamayaṃ tathā
virocanasya siddhāntaṃ pramāṇaṃ pratijajñire || 61 ||

Shrautiikartum svapaksham te koshamannamayam tathaa virochanasya siddhaantam pramaanam pratijajnire

अपने पक्ष को श्रुतिसम्मत बनाने के लिए उन्होंने अन्नमय कोश को और विरोचन के सिद्धान्त को प्रमाण बताया।

To make their position scriptural they put forward the sheath of food and the doctrine of Virocana as their authority.

जीवात्मनिर्गमे देहमरणस्यात्र दर्शनात्
देहातिरिक्त एवात्मेत्याहुर्लोकायताः परे ॥ ६२ ॥

jīvātmanirgame dehamaraṇasyātra darśanāt
dehātirikta evātmetyāhurlokāyatāḥ pare || 62 ||

Jiivaatmanirgame dehamaranasyaatra darshanaat dehaatirikta evaatmetyaahurlokaayataah pare

दूसरे लोकायत कहते हैं कि जीवात्मा के निकल जाने पर देह का मरना देखा जाता है, इसलिए आत्मा देह से भिन्न ही है।

Other materialists say that since the body is seen to die when the living self departs, the Self is other than the body.

प्रत्यक्षत्वेनाभिमताऽहंधीर्देहातिरेकिणम्
गमयेदिन्द्रियात्मानं वच्मीत्यादिप्रयोगतः ॥ ६३ ॥

pratyakṣatvenābhimatā'haṃdhīrdehātirekiṇam
gamayedindriyātmānaṃ vacmītyādiprayogataḥ || 63 ||

Pratyakshatvenaabhimataa'hamdhiirdehaatirekinam gamayedindriyaatmaanam vachmiityaadiprayogatah

प्रत्यक्ष मानी हुई 'अहम्' की बुद्धि देह से अतिरिक्त इन्द्रिय-रूप आत्मा तक ले जाती है, क्योंकि 'मैं बोलता हूँ' आदि प्रयोग होते हैं।

The notion 'I', taken as perceptual, leads on to a Self other than the body, namely the organs, since we say 'I speak' and the like.

वागादीनामिंद्रियाणां कलहः श्रुतिषु श्रुतः
तेन चैतन्यमेतेषामात्मत्वं तत एव हि ॥ ६४ ॥

vāgādīnāmiṃdriyāṇāṃ kalahaḥ śrutiṣu śrutaḥ
tena caitanyameteṣāmātmatvaṃ tata eva hi || 64 ||

Vaagaadiinaamimdriyaanaam kalahah shrutishu shrutah tena chaitanyameteshaamaatmatvam tata eva hi

श्रुतियों में वाक् आदि इन्द्रियों का कलह सुना जाता है; इससे इनका चैतन्य सिद्ध होता है, और इसी से इनका आत्मत्व।

In the scriptures a quarrel of the organs, speech and the rest, is heard; from that their sentience follows, and from that their being the Self.

हैरण्यगर्भाः प्राणात्मवादिनस्त्वेवमूचिरे
चक्षुराद्यक्षलोपेऽपि प्राणसत्वे तु जीवति ॥ ६५ ॥

hairaṇyagarbhāḥ prāṇātmavādinastvevamūcire
cakṣurādyakṣalope'pi prāṇasatve tu jīvati || 65 ||

Hairanyagarbhaah praanaatmavaadinastvevamuuchire chakshuraadyakshalope'pi praanasatve tu jiivati

प्राण को आत्मा मानने वाले हिरण्यगर्भ के अनुयायी ऐसा कहते हैं — चक्षु आदि इन्द्रियों के लोप होने पर भी, प्राण के रहते मनुष्य जीता है।

The followers of Hiraṇyagarbha, who hold the breath to be the Self, say this: even when eye and the other organs fail, a man lives so long as the breath is there.

प्राणो जागर्ति सुप्तेऽपि प्राणश्रैष्ठ्यादिकं श्रुतम्
कोशः प्राणमयस्सम्यग्विस्तरेण प्रपंचितः ॥ ६६ ॥

prāṇo jāgarti supte'pi prāṇaśraiṣṭhyādikaṃ śrutam
kośaḥ prāṇamayassamyagvistareṇa prapaṃcitaḥ || 66 ||

Praano jaagarti supte'pi praanashraishthyaadikam shrutam koshah praanamayassamyagvistarena prapamchitah

सोते हुए भी प्राण जागता है; श्रुति में प्राण की श्रेष्ठता आदि सुनी गई है; और प्राणमय कोश का विस्तार से भलीभाँति वर्णन किया गया है।

Even in sleep the breath is awake; scripture declares the pre-eminence of the breath; and the sheath of breath has been fully set out at length.

मन आत्मेति मन्यन्ते उपासनपरा जनाः
प्राणस्याभोक्तृता स्पष्ट भोक्तृत्वं मनसस्ततः ॥ ६७ ॥

mana ātmeti manyante upāsanaparā janāḥ
prāṇasyābhoktṛtā spaṣṭa bhoktṛtvaṃ manasastataḥ || 67 ||

Mana aatmeti manyante upaasanaparaa janaah praanasyaabhoktritaa spashta bhoktritvam manasastatah

उपासना में लगे लोग मन को आत्मा मानते हैं; प्राण का भोक्ता न होना स्पष्ट है, इसलिए भोक्तृत्व मन का है।

Men given to worship hold the mind to be the Self; that the breath is no enjoyer is plain, so enjoyership belongs to the mind.

मन एव मनुष्याणां कारणं बंधमोक्षयोः
श्रुतो मनोमयः कोशस्तेनात्मेतीरितं मनः ॥ ६८ ॥

mana eva manuṣyāṇāṃ kāraṇaṃ baṃdhamokṣayoḥ
śruto manomayaḥ kośastenātmetīritaṃ manaḥ || 68 ||

Mana eva manushyaanaam kaaranam bamdhamokshayoh shruto manomayah koshastenaatmetiiritam manah

'मन ही मनुष्यों के बन्ध और मोक्ष का कारण है'; मनोमय कोश श्रुति में सुना गया है — इसीलिए मन को आत्मा कहा गया।

'Mind alone is the cause of men's bondage and release'; the sheath of mind is declared in scripture — and so the mind is called the Self.

विज्ञानमात्मेति पर आहुः क्षणिकवादिनः
यतो विज्ञानमूलत्वं मनसो गम्यते स्फुटम् ॥ ६९ ॥

vijñānamātmeti para āhuḥ kṣaṇikavādinaḥ
yato vijñānamūlatvaṃ manaso gamyate sphuṭam || 69 ||

Vijnaanamaatmeti para aahuh kshanikavaadinah yato vijnaanamuulatvam manaso gamyate sphutam

दूसरे क्षणिकवादी विज्ञान को आत्मा कहते हैं, क्योंकि मन का मूल विज्ञान है — यह स्पष्ट समझ में आता है।

Others, who hold that all is momentary, call consciousness the Self, since it is plainly understood that the mind has consciousness for its root.

अहंवृत्तिरिदंवृत्तिरित्यन्तःकरणं द्विधा
विज्ञानं स्यादहंवृत्तिरिदंवृत्तिर्मनो भवेत् ॥ ७० ॥

ahaṃvṛttiridaṃvṛttirityantaḥkaraṇaṃ dvidhā
vijñānaṃ syādahaṃvṛttiridaṃvṛttirmano bhavet || 70 ||

Ahamvrittiridamvrittirityantahkaranam dvidhaa vijnaanam syaadahamvrittiridamvrittirmano bhavet

अन्तःकरण दो प्रकार का है — 'अहम्' वृत्ति और 'इदम्' वृत्ति; 'अहम्' वृत्ति विज्ञान है और 'इदम्' वृत्ति मन।

The inner organ is twofold, the movement 'I' and the movement 'this'; the movement 'I' is consciousness and the movement 'this' is mind.

अहंप्रत्ययबीजत्वमिदंवृत्तेरिति स्फुटम्
अविदित्वा स्वमात्मानं बाह्यं वेत्ति न तु क्वचित् ॥ ७१ ॥

ahaṃpratyayabījatvamidaṃvṛtteriti sphuṭam
aviditvā svamātmānaṃ bāhyaṃ vetti na tu kvacit || 71 ||

Ahampratyayabiijatvamidamvritteriti sphutam aviditvaa svamaatmaanam baahyam vetti na tu kvachit

'इदम्' वृत्ति का बीज 'अहम्' प्रत्यय है — यह स्पष्ट है; क्योंकि अपने को जाने बिना कोई कहीं बाहरी वस्तु को नहीं जानता।

That the notion 'I' is the seed of the movement 'this' is plain; for without knowing oneself no one anywhere knows an outward thing.

क्षणे क्षणे जन्मनाशावहंवृत्तेर्मितौ यतः
विज्ञानं क्षणिकं तेन स्वप्रकाशं स्वतो मितेः ॥ ७२ ॥

kṣaṇe kṣaṇe janmanāśāvahaṃvṛttermitau yataḥ
vijñānaṃ kṣaṇikaṃ tena svaprakāśaṃ svato miteḥ || 72 ||

Kshane kshane janmanaashaavahamvrittermitau yatah vijnaanam kshanikam tena svaprakaasham svato miteh

'अहम्' वृत्ति के जन्म और नाश क्षण-क्षण में मापे जाते हैं; इसलिए विज्ञान क्षणिक है, और स्वयं से ही मापा जाने के कारण स्वयंप्रकाश है।

The birth and death of the movement 'I' are measured moment by moment; so consciousness is momentary, and being measured of itself, it is self-luminous.

विज्ञानमयकोशोऽयं जीव इत्यागमा जगुः
सर्वसंसार एतस्य जन्मनाशसुखादिकः ॥ ७३ ॥

vijñānamayakośo'yaṃ jīva ityāgamā jaguḥ
sarvasaṃsāra etasya janmanāśasukhādikaḥ || 73 ||

Vijnaanamayakosho'yam jiiva ityaagamaa jaguh sarvasamsaara etasya janmanaashasukhaadikah

आगम कहते हैं कि यह विज्ञानमय कोश ही जीव है; जन्म, नाश, सुख आदि सारा संसार इसी का है।

The traditional texts say that this sheath of understanding is the soul; birth, death, pleasure and the whole round of the world belong to it.

विज्ञानं क्षणिकं नात्मा विद्युदभ्रनिमेषवत्
अन्यस्यानुपलब्धत्वाच्छून्यं माध्यमिका जगुः ॥ ७४ ॥

vijñānaṃ kṣaṇikaṃ nātmā vidyudabhranimeṣavat
anyasyānupalabdhatvācchūnyaṃ mādhyamikā jaguḥ || 74 ||

Vijnaanam kshanikam naatmaa vidyudabhranimeshavat anyasyaanupalabdhatvaachchhuunyam maadhyamikaa jaguh

विज्ञान क्षणिक है, बिजली, बादल और पलक की तरह; अतः वह आत्मा नहीं — और दूसरा कुछ उपलब्ध नहीं होता, इसलिए शून्य ही है, ऐसा माध्यमिक कहते हैं।

Consciousness is momentary, like lightning, cloud and the blink of an eye, and so is not the Self; and since nothing else is found, the Mādhyamikas say all is void.

असदेवेदमित्यादाविदमेव श्रुतं ततः
ज्ञानज्ञेयात्मकं सर्वं जगद्भ्रान्तिप्रकल्पितम् ॥ ७५ ॥

asadevedamityādāvidameva śrutaṃ tataḥ
jñānajñeyātmakaṃ sarvaṃ jagadbhrāntiprakalpitam || 75 ||

Asadevedamityaadaavidameva shrutam tatah jnaanajneyaatmakam sarvam jagadbhraantiprakalpitam

'यह पहले असत् ही था' आदि में 'इदम्' ही सुना गया है; अतः ज्ञान और ज्ञेय-रूप समस्त जगत् भ्रान्ति से कल्पित है।

In 'this was non-being alone in the beginning' and the like, it is 'this' that is spoken of; so the whole world, of knowledge and of the known, is imagined by error.

निरधिष्ठानविभ्रान्तेरभावादात्मनोऽस्तिता
शून्यस्यापि ससाक्षित्वादन्यथा नोक्तिरस्य ते ॥ ७६ ॥

niradhiṣṭhānavibhrānterabhāvādātmano'stitā
śūnyasyāpi sasākṣitvādanyathā noktirasya te || 76 ||

Niradhishthaanavibhraanterabhaavaadaatmano'stitaa shuunyasyaapi sasaakshitvaadanyathaa noktirasya te

अधिष्ठान के बिना भ्रान्ति नहीं होती, इसलिए आत्मा का अस्तित्व सिद्ध है; और शून्य का भी साक्षी होने से ही तुम्हारा यह कथन बनता है, अन्यथा नहीं।

Since there is no error without a ground, the being of the Self stands; and only because the void too has a witness can you say what you say, not otherwise.

अन्यो विज्ञानमयत आनंदमय आन्तरः
अस्तीत्येवोपलब्धव्य इति वैदिकदर्शनम् ॥ ७७ ॥

anyo vijñānamayata ānaṃdamaya āntaraḥ
astītyevopalabdhavya iti vaidikadarśanam || 77 ||

Anyo vijnaanamayata aanamdamaya aantarah astiityevopalabdhavya iti vaidikadarshanam

'विज्ञानमय से भिन्न, उससे भीतर आनन्दमय है; वह है ही — ऐसा ही उसे जानना चाहिए' — यही वैदिक दर्शन है।

'Other than the sheath of understanding, and within it, is the sheath of bliss; it simply is, and so must it be known' — this is the view of the Veda.

अणुर्महान् मध्यमो वेत्येवं तत्रापि वादिनः
बहुधा विवदन्ते हि श्रुतियुक्तिसमाश्रयात् ॥ ७८ ॥

aṇurmahān madhyamo vetyevaṃ tatrāpi vādinaḥ
bahudhā vivadante hi śrutiyuktisamāśrayāt || 78 ||

Anurmahaan madhyamo vetyevam tatraapi vaadinah bahudhaa vivadante hi shrutiyuktisamaashrayaat

वहाँ भी वादी अणु, महान् या मध्यम — इस प्रकार श्रुति और युक्ति का आश्रय लेकर अनेक प्रकार से विवाद करते हैं।

There too the disputants quarrel in many ways, leaning on scripture and reasoning, whether it be atomic, great, or of middle size.

अणुं वदन्त्यान्तराळास्सूक्ष्मनाडीप्रचारतः
रोम्णः सहस्रभागेन तुल्यासु प्रचरत्ययम् ॥ ७९ ॥

aṇuṃ vadantyāntarāḻāssūkṣmanāḍīpracārataḥ
romṇaḥ sahasrabhāgena tulyāsu pracaratyayam || 79 ||

Anum vadantyaantaraalaassuukshmanaadiiprachaaratah romnah sahasrabhaagena tulyaasu pracharatyayam

आन्तराल वाले उसे अणु कहते हैं, क्योंकि वह सूक्ष्म नाड़ियों में चलता है — रोम के हज़ारवें भाग के बराबर नाड़ियों में यह चलता है।

The Āntarālas call it atomic, because it moves in subtle channels; it moves in channels as fine as a thousandth part of a hair.

अणोरणीयानेषोऽणुः सूक्ष्मात्सूक्ष्मतरं त्विति
अणुत्वमाहुः श्रुतयः शतशोऽथ सहस्रशः ॥ ८० ॥

aṇoraṇīyāneṣo'ṇuḥ sūkṣmātsūkṣmataraṃ tviti
aṇutvamāhuḥ śrutayaḥ śataśo'tha sahasraśaḥ || 80 ||

Anoraniiyaanesho'nuh suukshmaatsuukshmataram tviti anutvamaahuh shrutayah shatasho'tha sahasrashah

'यह अणु से भी अणु है', 'सूक्ष्म से भी सूक्ष्मतर है' — इस प्रकार सैकड़ों और हज़ारों श्रुतियाँ उसकी अणुता कहती हैं।

'This is smaller than the atom', 'subtler than the subtle' — thus hundreds and thousands of scriptures speak of its minuteness.

वालाग्रशतभागस्य शतधा कल्पितस्य च
भागो जीवस्य विज्ञेय इति चाहापरा श्रुतिः ॥ ८१ ॥

vālāgraśatabhāgasya śatadhā kalpitasya ca
bhāgo jīvasya vijñeya iti cāhāparā śrutiḥ || 81 ||

Vaalaagrashatabhaagasya shatadhaa kalpitasya cha bhaago jiivasya vijneya iti chaahaaparaa shrutih

'बाल के अग्रभाग के सौवें भाग के फिर सौ भाग किए जाएँ, उतना जीव का भाग जानना चाहिए' — ऐसा दूसरी श्रुति कहती है।

'Take the hundredth part of the tip of a hair and divide it again a hundred times — that is to be known as the measure of the soul', says another scripture.

दिगंबरा मध्यमत्वमाहुरापादमस्तकम्
चैतन्यव्याप्तिसंदृष्टेरानखाग्रश्रुतेरपि ॥ ८२ ॥

digaṃbarā madhyamatvamāhurāpādamastakam
caitanyavyāptisaṃdṛṣṭerānakhāgraśruterapi || 82 ||

Digambaraa madhyamatvamaahuraapaadamastakam chaitanyavyaaptisamdrishteraanakhaagrashruterapi

दिगम्बर उसे मध्यम कहते हैं — पैर से सिर तक; क्योंकि चैतन्य की व्याप्ति वहीं तक देखी जाती है, और 'नख के अग्रभाग तक' ऐसी श्रुति भी है।

The Digambaras call it of middle size, from foot to head, since awareness is seen to spread just so far, and scripture too says 'up to the finger-tips'.

सूक्ष्मनाडीप्रचारस्तु सूक्ष्मैरवयवैर्भवेत्
स्थूलदेहस्य हस्ताभ्यां कंचुकप्रतिमोकवत् ॥ ८३ ॥

sūkṣmanāḍīpracārastu sūkṣmairavayavairbhavet
sthūladehasya hastābhyāṃ kaṃcukapratimokavat || 83 ||

Suukshmanaadiiprachaarastu suukshmairavayavairbhavet sthuuladehasya hastaabhyaam kamchukapratimokavat

सूक्ष्म नाड़ियों में उसका चलना सूक्ष्म अवयवों से होता है — जैसे स्थूल देह का हाथों से कञ्चुक उतारना।

Its moving in the subtle channels takes place by its subtle parts, as the gross body slips off a garment with its hands.

न्यूनाधिकशरीरेषु प्रवेशोऽपि गमागमैः
आत्मांशानां भवेत्तेन मध्यमत्वं विनिश्चितम् ॥ ८४ ॥

nyūnādhikaśarīreṣu praveśo'pi gamāgamaiḥ
ātmāṃśānāṃ bhavettena madhyamatvaṃ viniścitam || 84 ||

Nyuunaadhikashariireshu pravesho'pi gamaagamaih aatmaamshaanaam bhavettena madhyamatvam vinishchitam

छोटे और बड़े शरीरों में प्रवेश भी आत्मा के अंशों के आने-जाने से होता है; इसलिए उसका मध्यम होना निश्चित है।

Its entry into bodies smaller and larger too takes place by the coming and going of the Self's parts; hence its middle size is established.

सांशस्य घटवन्नाशो भवत्येव तथा सति
कृतनाशाकृताभ्यागमयोः को वारको भवेत् ॥ ८५ ॥

sāṃśasya ghaṭavannāśo bhavatyeva tathā sati
kṛtanāśākṛtābhyāgamayoḥ ko vārako bhavet || 85 ||

Saamshasya ghatavannaasho bhavatyeva tathaa sati kritanaashaakritaabhyaagamayoh ko vaarako bhavet

पर ऐसा होने पर, अंश वाले की घड़े की तरह नाश अवश्य होगा; तब किए हुए का नाश और न किए हुए की प्राप्ति — इन्हें कौन रोकेगा?

But then, having parts, it must perish like a pot; and who then will ward off the loss of what was done and the coming of what was not done?

तस्मादात्मा महानेव नैवाणुर्नापि मध्यमः
आकाशवत्सर्वगतो निरंशः श्रुतिसम्मतः ॥ ८६ ॥

tasmādātmā mahāneva naivāṇurnāpi madhyamaḥ
ākāśavatsarvagato niraṃśaḥ śrutisammataḥ || 86 ||

Tasmaadaatmaa mahaaneva naivaanurnaapi madhyamah aakaashavatsarvagato niramshah shrutisammatah

इसलिए आत्मा महान् ही है — न अणु, न मध्यम; वह आकाश की तरह सर्वगत और निरंश है, और श्रुति को यही सम्मत है।

Therefore the Self is great alone — neither atomic nor of middle size; it is all-pervading like space and without parts, and this is what scripture approves.

इत्युक्त्वा तद्विशेषे तु बहुधा कलहं ययुः
अचिद्रूपोऽथ चिद्रूपश्चिदचिद्रूप इत्यपि ॥ ८७ ॥

ityuktvā tadviśeṣe tu bahudhā kalahaṃ yayuḥ
acidrūpo'tha cidrūpaścidacidrūpa ityapi || 87 ||

Ityuktvaa tadvisheshe tu bahudhaa kalaham yayuh achidruupo'tha chidruupashchidachidruupa ityapi

यह कहकर भी उसके विशेष स्वरूप पर वे अनेक प्रकार से झगड़ने लगे — कोई कहता है अचिद्रूप, कोई चिद्रूप, कोई चिदचिद्रूप।

Having said this, they fell to quarrelling in many ways about its particular nature — some saying it is unconscious, some conscious, some both.

प्राभाकरास्तार्किकाश्च प्राहुरस्याचिदात्मताम्
आकाशवद्द्रव्यमात्मा शब्दवत्तद्गुणाश्चितिः ॥ ८८ ॥

prābhākarāstārkikāśca prāhurasyācidātmatām
ākāśavaddravyamātmā śabdavattadguṇāścitiḥ || 88 ||

Praabhaakaraastaarkikaashcha praahurasyaachidaatmataam aakaashavaddravyamaatmaa shabdavattadgunaashchitih

प्राभाकर और तार्किक इसे अचित्-स्वरूप कहते हैं; आत्मा आकाश की तरह द्रव्य है, और चिति उसका गुण है, जैसे शब्द आकाश का।

The Prābhākaras and the logicians call it unconscious in nature; the Self is a substance like space, and awareness is its quality, as sound is of space.

इच्छाद्वेषप्रयत्नाश्च धर्माधर्मौ सुखासुखे
तत्संस्काराश्च तस्यैते गुणाश्चितिवदीरिताः ॥ ८९ ॥

icchādveṣaprayatnāśca dharmādharmau sukhāsukhe
tatsaṃskārāśca tasyaite guṇāścitivadīritāḥ || 89 ||

Ichchhaadveshaprayatnaashcha dharmaadharmau sukhaasukhe tatsamskaaraashcha tasyaite gunaashchitivadiiritaah

इच्छा, द्वेष, प्रयत्न, धर्म और अधर्म, सुख और दुःख तथा उनके संस्कार — ये सब चिति की तरह उसके गुण कहे गए हैं।

Desire, aversion, effort, merit and demerit, pleasure and pain, and the impressions of these — all these are called its qualities, as awareness is.

आत्मनो मनसा योगे स्वादृष्टवशतो गुणाः
जायन्तेऽथ प्रलीयन्ते सुषुप्तेऽदृष्टसंक्षयात् ॥ ९० ॥

ātmano manasā yoge svādṛṣṭavaśato guṇāḥ
jāyante'tha pralīyante suṣupte'dṛṣṭasaṃkṣayāt || 90 ||

Aatmano manasaa yoge svaadrishtavashato gunaah jaayante'tha praliiyante sushupte'drishtasamkshayaat

आत्मा का मन से योग होने पर अपने अदृष्ट के वश से गुण उत्पन्न होते हैं; और सुषुप्ति में अदृष्ट के क्षय से वे लीन हो जाते हैं।

When the Self joins with the mind, its qualities arise by the force of its unseen merit; and in deep sleep, as that unseen merit is spent, they dissolve.

चितिमत्त्वाच्चेतनोऽयमिच्छाद्वेषप्रयत्नवान्
स्याद्धर्माधर्मयोः कर्ता भोक्ता दुःखादिमत्त्वतः ॥ ९१ ॥

citimattvāccetano'yamicchādveṣaprayatnavān
syāddharmādharmayoḥ kartā bhoktā duḥkhādimattvataḥ || 91 ||

Chitimattvaachchetano'yamichchhaadveshaprayatnavaan syaaddharmaadharmayoh kartaa bhoktaa duhkhaadimattvatah

चिति वाला होने से यह चेतन है; इच्छा, द्वेष और प्रयत्न वाला है; धर्म और अधर्म का कर्ता है; और दुःख आदि वाला होने से भोक्ता है।

Having awareness it is sentient; having desire, aversion and effort it is the doer of merit and demerit; and having pain and the rest it is the enjoyer.

यथाऽत्र कर्मवशतः कादाचित्कं सुखादिकम्
तथा लोकान्तरे देहे कर्मणेच्छादि जन्यते ॥ ९२ ॥

yathā'tra karmavaśataḥ kādācitkaṃ sukhādikam
tathā lokāntare dehe karmaṇecchādi janyate || 92 ||

Yathaa'tra karmavashatah kaadaachitkam sukhaadikam tathaa lokaantare dehe karmanechchhaadi janyate

जैसे यहाँ कर्म के वश से सुख आदि कभी-कभी होते हैं, वैसे ही दूसरे लोक के शरीर में भी कर्म से इच्छा आदि उत्पन्न होते हैं।

As here pleasure and the rest arise now and then by the force of deeds, so in a body in another world desire and the rest are produced by deeds.

एवं सर्वगतस्यापि सम्भवेताम् गमागमौ
कर्मकांडस्समग्रोऽत्र प्रमाणमिति ते ब्रुवन् ॥ ९३ ॥

evaṃ sarvagatasyāpi sambhavetām gamāgamau
karmakāṃḍassamagro'tra pramāṇamiti te bruvan || 93 ||

Evam sarvagatasyaapi sambhavetaam gamaagamau karmakaamdassamagro'tra pramaanamiti te bruvan

इस प्रकार सर्वगत होने पर भी उसका आना-जाना बन सकता है; और यहाँ सारा कर्मकाण्ड प्रमाण है — ऐसा वे कहते हैं।

In this way, though it is all-pervading, its going and coming can stand; and the whole ritual portion of the Veda is here their authority, so they say.

आनंदमयकोशो यः सुषुप्तौ परिशिष्यते
अस्पष्टचित्स आत्मैषां पूर्वकोशोऽस्य ते गुणाः ॥ ९४ ॥

ānaṃdamayakośo yaḥ suṣuptau pariśiṣyate
aspaṣṭacitsa ātmaiṣāṃ pūrvakośo'sya te guṇāḥ || 94 ||

Aanamdamayakosho yah sushuptau parishishyate aspashtachitsa aatmaishaam puurvakosho'sya te gunaah

जो आनन्दमय कोश सुषुप्ति में शेष रहता है, वही इनके मत में अस्पष्ट चित् आत्मा है; और पहले वाले कोश इसके गुण हैं।

The sheath of bliss that remains in deep sleep is, on their view, the Self with awareness dim; and the earlier sheaths are its qualities.

गूढं चैतन्यमुत्प्रेक्ष्य जडबोधस्वरूपताम्
आत्मनो ब्रुवते भाट्टाश्चिदुत्प्रेक्षोत्थितस्मृतेः ॥ ९५ ॥

gūḍhaṃ caitanyamutprekṣya jaḍabodhasvarūpatām
ātmano bruvate bhāṭṭāścidutprekṣotthitasmṛteḥ || 95 ||

Guudham chaitanyamutprekshya jadabodhasvaruupataam aatmano bruvate bhaattaashchidutprekshotthitasmriteh

चैतन्य के गूढ़ होने की कल्पना करके भाट्ट आत्मा को जड़ और बोध — दोनों स्वरूप वाला कहते हैं, क्योंकि चित् की कल्पना से स्मृति उत्पन्न होती है।

Imagining awareness to be hidden, the Bhāṭṭas call the Self both inert and aware in nature, since memory arises from the supposal of awareness.

जडो भूत्वा तदाऽस्वाप्समिति जाड्यस्मृतिस्तथा
विना जाड्यानुभूतिं न कथंचिदुपपद्यते ॥ ९६ ॥

jaḍo bhūtvā tadā'svāpsamiti jāḍyasmṛtistathā
vinā jāḍyānubhūtiṃ na kathaṃcidupapadyate || 96 ||

Jado bhuutvaa tadaa'svaapsamiti jaadyasmritistathaa vinaa jaadyaanubhuutim na kathamchidupapadyate

'मैं जड़ होकर सोया' — यह जड़ता की स्मृति जड़ता के अनुभव के बिना किसी प्रकार नहीं बनती।

'I slept, having become inert' — this memory of inertness cannot in any way be accounted for without an experience of inertness.

द्रष्टुर्दृष्टेरलोपश्च श्रुतस्सुप्तौ ततस्स्वयम्
अप्रकाशप्रकाशाभ्यामात्मा खद्योतवद्द्युतः ॥ ९७ ॥

draṣṭurdṛṣṭeralopaśca śrutassuptau tatassvayam
aprakāśaprakāśābhyāmātmā khadyotavaddyutaḥ || 97 ||

Drashturdrishteralopashcha shrutassuptau tatassvayam aprakaashaprakaashaabhyaamaatmaa khadyotavaddyutah

'द्रष्टा की दृष्टि का लोप नहीं होता' — यह सुषुप्ति के विषय में सुना गया है; अतः अप्रकाश और प्रकाश — दोनों से आत्मा जुगनू की तरह चमकता है।

'The seer's seeing is not lost' — so it is heard of deep sleep; and thus by non-light and light the Self glimmers like a firefly.

निरंशस्योभयात्मत्वं न कथंचिद्घटिष्यते
तेन चिद्रूप एवात्मेत्याहुस्सांख्यविवेकिनः ॥ ९८ ॥

niraṃśasyobhayātmatvaṃ na kathaṃcidghaṭiṣyate
tena cidrūpa evātmetyāhussāṃkhyavivekinaḥ || 98 ||

Niramshasyobhayaatmatvam na kathamchidghatishyate tena chidruupa evaatmetyaahussaamkhyavivekinah

निरंश में दोनों स्वरूपों का होना किसी प्रकार नहीं बनता; इसलिए साङ्ख्य विवेकी कहते हैं कि आत्मा चिद्रूप ही है।

In what is partless a double nature can in no way stand; therefore the discerning Sāṅkhyas say the Self is awareness alone.

जाड्यांशः प्रकृते रूपं विकारित्रिगुणं च तत्
चितो भोगापवर्गार्थं प्रकृतिस्सा प्रवर्तते ॥ ९९ ॥

jāḍyāṃśaḥ prakṛte rūpaṃ vikāritriguṇaṃ ca tat
cito bhogāpavargārthaṃ prakṛtissā pravartate || 99 ||

Jaadyaamshah prakrite ruupam vikaaritrigunam cha tat chito bhogaapavargaartham prakritissaa pravartate

जड़ता का अंश प्रकृति का रूप है, और वह विकारी तथा त्रिगुणात्मक है; चित् के भोग और अपवर्ग के लिए वह प्रकृति प्रवृत्त होती है।

The inert portion is the form of nature, changeful and of three qualities; that nature works for the enjoyment and the release of the conscious one.

असंगायाश्चितेर्बन्धमोक्षौ भेदाग्रहान्मतौ
बंधमुक्तिव्यवस्थार्थं पूर्वेषामिव चिद्भिदा ॥ १०० ॥

asaṃgāyāściterbandhamokṣau bhedāgrahānmatau
baṃdhamuktivyavasthārthaṃ pūrveṣāmiva cidbhidā || 100 ||

Asamgaayaashchiterbandhamokshau bhedaagrahaanmatau bamdhamuktivyavasthaartham puurveshaamiva chidbhidaa

असङ्ग चिति के बन्ध और मोक्ष भेद के न ग्रहण से माने जाते हैं; और बन्ध-मुक्ति की व्यवस्था के लिए, पूर्ववादियों की तरह, चितियों का भेद माना जाता है।

The bondage and release of the unattached awareness are held to come from not grasping the difference; and, as with the earlier schools, a plurality of conscious beings is assumed to keep bondage and release in order.

महतः परमव्यक्तमिति प्रकृतिरुच्यते
श्रुतावसंगता तद्वदसंगो हीत्यतिस्फुटा ॥ १०१ ॥

mahataḥ paramavyaktamiti prakṛtirucyate
śrutāvasaṃgatā tadvadasaṃgo hītyatisphuṭā || 101 ||

Mahatah paramavyaktamiti prakritiruchyate shrutaavasamgataa tadvadasamgo hiityatisphutaa

'महत् से परे अव्यक्त है' — इस प्रकार श्रुति में प्रकृति कही जाती है; वैसे ही 'असङ्ग ही है' — इस वाक्य से (पुरुष की) असङ्गता अत्यन्त स्पष्ट है।

'Beyond the great is the unmanifest' — thus nature is spoken of in scripture; likewise the unattachedness (of the conscious one) is quite plain in 'he is indeed unattached'.

चित्सन्निधौ प्रवृत्तायाः प्रकृतेर्हि नियामकम्
ईश्वरं ब्रुवते योगाः स जीवेभ्यः परः श्रुतः ॥ १०२ ॥

citsannidhau pravṛttāyāḥ prakṛterhi niyāmakam
īśvaraṃ bruvate yogāḥ sa jīvebhyaḥ paraḥ śrutaḥ || 102 ||

Chitsannidhau pravrittaayaah prakriterhi niyaamakam iishvaram bruvate yogaah sa jiivebhyah parah shrutah

चित् के सान्निध्य में प्रवृत्त हुई प्रकृति का नियामक ईश्वर है — ऐसा योगी कहते हैं; वह जीवों से परे सुना गया है।

The yogins say that the Lord is the governor of nature when it works in the presence of awareness; he is declared to be beyond the souls.

प्रधानक्षेत्रज्ञपतिर्गुणेश इति हि श्रुतिः
आरण्यकेऽसंभ्रमेण ह्यन्तर्याम्युपपादितः ॥ १०३ ॥

pradhānakṣetrajñapatirguṇeśa iti hi śrutiḥ
āraṇyake'saṃbhrameṇa hyantaryāmyupapāditaḥ || 103 ||

Pradhaanakshetrajnapatirgunesha iti hi shrutih aaranyake'sambhramena hyantaryaamyupapaaditah

'प्रधान और क्षेत्रज्ञ का पति, गुणों का ईश' — ऐसी श्रुति है; और आरण्यक में बिना किसी भ्रम के अन्तर्यामी का प्रतिपादन किया गया है।

'Lord of nature and of the knower of the field, ruler of the qualities' — so says scripture; and in the Āraṇyaka the inner ruler is set forth without confusion.

अत्रापि कलहायन्ते वादिनः स्वस्वयुक्तिभिः
वाक्यान्यपि यथाप्रज्ञम् दार्ढ्यायोदाहरन्ति हि ॥ १०४ ॥

atrāpi kalahāyante vādinaḥ svasvayuktibhiḥ
vākyānyapi yathāprajñam dārḍhyāyodāharanti hi || 104 ||

Atraapi kalahaayante vaadinah svasvayuktibhih vaakyaanyapi yathaaprajnam daardhyaayodaaharanti hi

यहाँ भी वादी अपनी-अपनी युक्तियों से झगड़ते हैं, और अपनी समझ के अनुसार दृढ़ता के लिए वाक्य भी उद्धृत करते हैं।

Here too the disputants quarrel with their several arguments, and each quotes texts, as his understanding goes, to make his view firm.

क्लेशकर्मविपाकैस्तदाशयैरप्यसंयुतः
पुम्विशेषो भवेदीशो जीववत्सोऽप्यसंगचित् ॥ १०५ ॥

kleśakarmavipākaistadāśayairapyasaṃyutaḥ
pumviśeṣo bhavedīśo jīvavatso'pyasaṃgacit || 105 ||

Kleshakarmavipaakaistadaashayairapyasamyutah pumvishesho bhavediisho jiivavatso'pyasamgachit

क्लेश, कर्म, विपाक और उनके आशयों से भी असंयुक्त कोई विशेष पुरुष ईश्वर है; वह भी जीव की तरह असङ्ग चित् ही है।

A special person, untouched by affliction, action, their ripening and the traces of these, is the Lord; he too, like the soul, is unattached awareness.

तथापि पुंविशेषत्वाद्घटतेऽस्य नियन्तृता
अव्यवस्थौ बंधमोक्षावापतेतामिहान्यथा ॥ १०६ ॥

tathāpi puṃviśeṣatvādghaṭate'sya niyantṛtā
avyavasthau baṃdhamokṣāvāpatetāmihānyathā || 106 ||

Tathaapi pumvisheshatvaadghatate'sya niyantritaa avyavasthau bamdhamokshaavaapatetaamihaanyathaa

फिर भी पुरुष-विशेष होने से उसका नियन्तृत्व बनता है; अन्यथा यहाँ बन्ध और मोक्ष अव्यवस्थित हो जाते।

Still, being a special person, his governorship holds good; otherwise bondage and release would here fall into disorder.

भीषास्मादित्येवमादावसंगस्य परात्मनः
श्रुतं तद्युक्तमप्यस्य क्लेशकर्माद्यसंगमात् ॥ १०७ ॥

bhīṣāsmādityevamādāvasaṃgasya parātmanaḥ
śrutaṃ tadyuktamapyasya kleśakarmādyasaṃgamāt || 107 ||

Bhiishaasmaadityevamaadaavasamgasya paraatmanah shrutam tadyuktamapyasya kleshakarmaadyasamgamaat

'इसके भय से' इत्यादि में असङ्ग परमात्मा के विषय में जो सुना गया है, वह भी उसके क्लेश और कर्म आदि से असंग होने के कारण उचित ही है।

What is heard in 'from fear of him' and the like about the unattached supreme Self is fitting too, since he is untouched by affliction and action.

जीवानामप्यसंगत्वात् क्लेशादिर्न ह्यथापि च
विवेकाग्रहतः क्लेशकर्मादि प्रागुदीरितम् ॥ १०८ ॥

jīvānāmapyasaṃgatvāt kleśādirna hyathāpi ca
vivekāgrahataḥ kleśakarmādi prāgudīritam || 108 ||

Jiivaanaamapyasamgatvaat kleshaadirna hyathaapi cha vivekaagrahatah kleshakarmaadi praagudiiritam

जीव भी असङ्ग हैं, इसलिए उनमें क्लेश आदि नहीं हैं; फिर भी विवेक के न होने से क्लेश और कर्म आदि पहले कहे जा चुके हैं।

The souls too are unattached, so affliction and the rest are not theirs; yet, for want of discernment, affliction and action have already been spoken of as theirs.

नित्यज्ञानप्रयत्नेच्छागुणानीशस्य मन्वते
असंगस्य नियन्तृत्वमयुक्तमिति तार्किकाः ॥ १०९ ॥

nityajñānaprayatnecchāguṇānīśasya manvate
asaṃgasya niyantṛtvamayuktamiti tārkikāḥ || 109 ||

Nityajnaanaprayatnechchhaagunaaniishasya manvate asamgasya niyantritvamayuktamiti taarkikaah

तार्किक ईश्वर के नित्य ज्ञान, प्रयत्न और इच्छा — ये गुण मानते हैं, क्योंकि असङ्ग का नियन्तृत्व उन्हें अनुचित लगता है।

The logicians hold that the Lord has eternal knowledge, effort and desire as qualities, since to them the governorship of an unattached being seems unfitting.

पुंविशेषत्वमप्यस्य गुणैरेव न चान्यथा
सत्यकामः सत्यसंकल्प इत्यादिश्रुतिर्जगौ ॥ ११० ॥

puṃviśeṣatvamapyasya guṇaireva na cānyathā
satyakāmaḥ satyasaṃkalpa ityādiśrutirjagau || 110 ||

Pumvisheshatvamapyasya gunaireva na chaanyathaa satyakaamah satyasamkalpa ityaadishrutirjagau

उसका पुरुष-विशेष होना भी गुणों से ही है, और किसी प्रकार नहीं; 'सत्यकाम, सत्यसंकल्प' आदि श्रुति ने यही गाया है।

His being a special person too comes from those qualities and not otherwise; scripture sang this in 'whose desires are true, whose will is true'.

नित्यज्ञानादिमत्वेऽस्य सृष्टिरेव सदा भवेत्
हिरण्यगर्भ ईशोऽतो लिंगदेहेन संयुतः ॥ १११ ॥

nityajñānādimatve'sya sṛṣṭireva sadā bhavet
hiraṇyagarbha īśo'to liṃgadehena saṃyutaḥ || 111 ||

Nityajnaanaadimatve'sya srishtireva sadaa bhavet hiranyagarbha iisho'to limgadehena samyutah

यदि उसे नित्य ज्ञान आदि वाला माना जाए तो सृष्टि सदा ही होती रहेगी; इसलिए वह ईश्वर हिरण्यगर्भ है, जो लिङ्ग-देह से युक्त है।

If he has eternal knowledge and the rest, creation must go on always; so this Lord is hiraṇyagarbha, who is joined with a subtle body.

उद्गीथब्राह्मणे तस्य माहात्म्यमतिविस्तृतम्
लिंगसत्वेऽपि जीवत्वं नास्य कर्माद्यभावतः ॥ ११२ ॥

udgīthabrāhmaṇe tasya māhātmyamativistṛtam
liṃgasatve'pi jīvatvaṃ nāsya karmādyabhāvataḥ || 112 ||

Udgiithabraahmane tasya maahaatmyamativistritam limgasatve'pi jiivatvam naasya karmaadyabhaavatah

उद्गीथ-ब्राह्मण में उसका माहात्म्य बहुत विस्तार से कहा गया है; लिङ्ग-देह होने पर भी कर्म आदि के अभाव से उसका जीवत्व नहीं है।

In the Udgītha section his greatness is told at great length; though he has a subtle body, he is not a soul, since deeds and the rest are absent in him.

स्थूलदेहं विना लिंगदेहो न क्वापि दृश्यते
वैराजो देह ईशोऽतः सर्वतो मस्तकादिमान् ॥ ११३ ॥

sthūladehaṃ vinā liṃgadeho na kvāpi dṛśyate
vairājo deha īśo'taḥ sarvato mastakādimān || 113 ||

Sthuuladeham vinaa limgadeho na kvaapi drishyate vairaajo deha iisho'tah sarvato mastakaadimaan

स्थूल देह के बिना लिङ्ग-देह कहीं देखा नहीं जाता; अतः ईश्वर वैराज देह वाला है — सब ओर से मस्तक आदि वाला।

Nowhere is a subtle body seen without a gross one; so the Lord has the cosmic body, with heads and the rest on every side.

सहस्रशीर्षेत्येवम् च विश्वतश्चक्षुरित्यपि
श्रुतमित्याहुरनिशं विश्वरूपस्य चिन्तकाः ॥ ११४ ॥

sahasraśīrṣetyevam ca viśvataścakṣurityapi
śrutamityāhuraniśaṃ viśvarūpasya cintakāḥ || 114 ||

Sahasrashiirshetyevam cha vishvatashchakshurityapi shrutamityaahuranisham vishvaruupasya chintakaah

'सहस्र सिर वाला' और 'सब ओर आँख वाला' — ऐसा सुना गया है; निरन्तर विश्वरूप का चिन्तन करने वाले ऐसा कहते हैं।

'Thousand-headed' and 'with eyes on every side' — so it is heard; those who constantly contemplate the cosmic form say this.

सर्वतः पाणिपादत्वे कृम्यादेरपीशता
ततश्चतुर्मुखो देव एवेशो नेतरः पुमान् ॥ ११५ ॥

sarvataḥ pāṇipādatve kṛmyāderapīśatā
tataścaturmukho deva eveśo netaraḥ pumān || 115 ||

Sarvatah paanipaadatve krimyaaderapiishataa tatashchaturmukho deva evesho netarah pumaan

यदि सब ओर हाथ-पैर होने से ईश्वरता हो, तो कीड़े आदि की भी ईश्वरता हो जाएगी; इसलिए चतुर्मुख ब्रह्मा ही ईश्वर है, कोई दूसरा पुरुष नहीं।

If lordship followed from having hands and feet on every side, a worm too would be lord; therefore the four-faced god alone is the Lord, no other person.

पुत्रार्थं तमुपासीना एवमाहुः प्रजापतिः
प्रजा असृजतेत्यादि श्रतिं चोदाहरन्त्यमी ॥ ११६ ॥

putrārthaṃ tamupāsīnā evamāhuḥ prajāpatiḥ
prajā asṛjatetyādi śratiṃ codāharantyamī || 116 ||

Putraartham tamupaasiinaa evamaahuh prajaapatih prajaa asrijatetyaadi shratim chodaaharantyamii

पुत्र के लिए उसकी उपासना करने वाले ऐसा कहते हैं, और 'प्रजापति ने प्रजा उत्पन्न की' इत्यादि श्रुति को उद्धृत करते हैं।

Those who worship him for offspring say this, and they quote such scripture as 'Prajāpati created creatures'.

विष्णोर्नाभेः समुद्भूतो वेधाः कमलजस्ततः
विष्णुरेवेश इत्याहुर्लोके भागवता जनाः ॥ ११७ ॥

viṣṇornābheḥ samudbhūto vedhāḥ kamalajastataḥ
viṣṇureveśa ityāhurloke bhāgavatā janāḥ || 117 ||

Vishnornaabheh samudbhuuto vedhaah kamalajastatah vishnurevesha ityaahurloke bhaagavataa janaah

लोक में भागवत जन कहते हैं कि विष्णु की नाभि से कमल में उत्पन्न ब्रह्मा हुए, इसलिए विष्णु ही ईश्वर हैं।

In the world the Bhāgavatas say that from Viṣṇu's navel the lotus-born creator arose, and that therefore Viṣṇu alone is the Lord.

शिवस्य पादावन्वेष्टुम् शार्ङ्ग्यशक्तस्ततश्शिवः
ईशो न विष्णुरित्याहुः शैवा आगममानिनः ॥ ११८ ॥

śivasya pādāvanveṣṭum śārṅgyaśaktastataśśivaḥ
īśo na viṣṇurityāhuḥ śaivā āgamamāninaḥ || 118 ||

Shivasya paadaavanveshtum shaarngyashaktastatashshivah iisho na vishnurityaahuh shaivaa aagamamaaninah

शिव के चरणों को खोजने में शार्ङ्गी (विष्णु) असमर्थ हुए, इसलिए शिव ही ईश्वर हैं, विष्णु नहीं — ऐसा आगम मानने वाले शैव कहते हैं।

The bearer of the Śārṅga bow was unable to find Śiva's feet, and so Śiva is the Lord and not Viṣṇu — so say the Śaivas, who trust their own scriptures.

पुरत्रयं साधयितुं विघ्नेशं सोऽप्यपूजयत्
विनायकं प्राहुरीशं गाणपत्यमते रताः ॥ ११९ ॥

puratrayaṃ sādhayituṃ vighneśaṃ so'pyapūjayat
vināyakaṃ prāhurīśaṃ gāṇapatyamate ratāḥ || 119 ||

Puratrayam saadhayitum vighnesham so'pyapuujayat vinaayakam praahuriisham gaanapatyamate rataah

तीनों पुरों को सिद्ध करने के लिए उसने भी विघ्नेश की पूजा की; अतः गाणपत्य मत में लगे लोग विनायक को ही ईश्वर कहते हैं।

To master the three cities he too worshipped the lord of obstacles; so those devoted to the Gāṇapatya view call Vināyaka the Lord.

एवमन्ये स्वस्वपक्षाभिमानेनान्यथान्यथा
मन्त्रार्थवादकल्पादीनाश्रित्य प्रतिपेदिरे ॥ १२० ॥

evamanye svasvapakṣābhimānenānyathānyathā
mantrārthavādakalpādīnāśritya pratipedire || 120 ||

Evamanye svasvapakshaabhimaanenaanyathaanyathaa mantraarthavaadakalpaadiinaashritya pratipedire

इसी प्रकार दूसरे लोग अपने-अपने पक्ष के अभिमान से भिन्न-भिन्न रूप में, मन्त्र, अर्थवाद और कल्प आदि का आश्रय लेकर अपनी-अपनी बात मानते हैं।

In the same way others, each proud of his own position, hold now this and now that, leaning on hymns, eulogies, ritual manuals and the rest.

अन्तर्यामिणमारभ्य स्थावरान्तेशवादिनः
सन्त्यश्वत्थार्कवंशादेः कुलदैवतदर्शनात् ॥ १२१ ॥

antaryāmiṇamārabhya sthāvarānteśavādinaḥ
santyaśvatthārkavaṃśādeḥ kuladaivatadarśanāt || 121 ||

Antaryaaminamaarabhya sthaavaraanteshavaadinah santyashvatthaarkavamshaadeh kuladaivatadarshanaat

अन्तर्यामी से लेकर स्थावर तक को ईश्वर कहने वाले लोग हैं, क्योंकि पीपल, आक, बाँस आदि को कुलदेवता के रूप में देखा जाता है।

There are those who call everything from the inner ruler down to unmoving things the Lord, since the fig, the milkweed, the bamboo and the rest are seen as family deities.

तत्वनिश्चयकामेन न्यायागमविचारिणाम्
एकैव प्रतिपत्तिः स्यात् साप्यत्र स्फुटमुच्यते ॥ १२२ ॥

tatvaniścayakāmena nyāyāgamavicāriṇām
ekaiva pratipattiḥ syāt sāpyatra sphuṭamucyate || 122 ||

Tatvanishchayakaamena nyaayaagamavichaarinaam ekaiva pratipattih syaat saapyatra sphutamuchyate

तत्त्व का निश्चय चाहने वाले, न्याय और आगम का विचार करने वालों की एक ही प्रतिपत्ति होनी चाहिए; वही यहाँ स्पष्ट कही जाती है।

For those who want certainty about the truth and who weigh reasoning and scripture there should be one single conclusion; and that is here plainly stated.

मायां तु प्रकृतिं विद्यान्मायिनं तु महेश्वरम्
अस्यावयवभूतैस्तु व्याप्तं सर्वमिदं जगत् ॥ १२३ ॥

māyāṃ tu prakṛtiṃ vidyānmāyinaṃ tu maheśvaram
asyāvayavabhūtaistu vyāptaṃ sarvamidaṃ jagat || 123 ||

Maayaam tu prakritim vidyaanmaayinam tu maheshvaram asyaavayavabhuutaistu vyaaptam sarvamidam jagat

'माया को प्रकृति जानो और मायी को महेश्वर; इसके अवयवभूतों से यह सारा जगत् व्याप्त है।'

'Know illusion to be nature and the wielder of illusion to be the great Lord; by the parts of him this whole world is pervaded.'

इति श्रुत्यनुसारेण न्याय्यो निर्णय ईश्वरे
तथा सत्यविरोधः स्यात् स्थावरान्तेशवादिनाम् ॥ १२४ ॥

iti śrutyanusāreṇa nyāyyo nirṇaya īśvare
tathā satyavirodhaḥ syāt sthāvarānteśavādinām || 124 ||

Iti shrutyanusaarena nyaayyo nirnaya iishvare tathaa satyavirodhah syaat sthaavaraanteshavaadinaam

इस श्रुति के अनुसार ईश्वर के विषय में यही निर्णय न्याय्य है; ऐसा होने पर स्थावर तक को ईश्वर कहने वालों से भी विरोध नहीं रहेगा।

According to this scripture, this is the just conclusion about the Lord; and so there will be no conflict even with those who call unmoving things the Lord.

माया चेयं तमोरूपा तापनीये तदीरणात्
अनुभूतिं तत्र मानं प्रतिजज्ञे श्रुतिः स्वयम् ॥ १२५ ॥

māyā ceyaṃ tamorūpā tāpanīye tadīraṇāt
anubhūtiṃ tatra mānaṃ pratijajñe śrutiḥ svayam || 125 ||

Maayaa cheyam tamoruupaa taapaniiye tadiiranaat anubhuutim tatra maanam pratijajne shrutih svayam

और यह माया तमोरूप है, क्योंकि तापनीय में ऐसा ही कहा गया है; वहाँ श्रुति ने स्वयं अनुभूति को ही प्रमाण बताया।

And this illusion is of the nature of darkness, for so the Tāpanīya declares; there scripture itself put forward experience as the proof.

जडं मोहात्मकं तच्चेत्यनुभावयति श्रुतिः
आबालगोपं स्पष्टत्वादानन्त्यं तस्य साऽब्रवीत् ॥ १२६ ॥

jaḍaṃ mohātmakaṃ taccetyanubhāvayati śrutiḥ
ābālagopaṃ spaṣṭatvādānantyaṃ tasya sā'bravīt || 126 ||

Jadam mohaatmakam tachchetyanubhaavayati shrutih aabaalagopam spashtatvaadaanantyam tasya saa'braviit

'वह जड़ और मोह-रूप है' — ऐसा श्रुति अनुभव कराती है; और बालक और ग्वाले तक को स्पष्ट होने के कारण श्रुति ने उसकी अनन्तता कही।

'It is inert and of the nature of bewilderment' — so scripture makes us experience it; and, since it is plain even to children and cowherds, scripture declared its endlessness.

अचिदात्मघटादीनां यत्स्वरूपं जडं हि तत्
यत्र कुंठीभवेद्बुद्धिः स मोह इति लौकिकाः ॥ १२७ ॥

acidātmaghaṭādīnāṃ yatsvarūpaṃ jaḍaṃ hi tat
yatra kuṃṭhībhavedbuddhiḥ sa moha iti laukikāḥ || 127 ||

Achidaatmaghataadiinaam yatsvaruupam jadam hi tat yatra kumthiibhavedbuddhih sa moha iti laukikaah

अचेतन घट आदि का जो स्वरूप है वही जड़ है; और जहाँ बुद्धि कुण्ठित हो जाती है उसे लौकिक लोग मोह कहते हैं।

The nature of insentient pots and the rest is inertness; and where the understanding is blunted, worldly men call that bewilderment.

इत्थं लौकिकदृष्ट्यैतत्सर्वैरप्यनुभूयते
युक्तिदृष्ट्या त्वनिर्वाच्यं नासदासीदिति श्रुतेः ॥ १२८ ॥

itthaṃ laukikadṛṣṭyaitatsarvairapyanubhūyate
yuktidṛṣṭyā tvanirvācyaṃ nāsadāsīditi śruteḥ || 128 ||

Ittham laukikadrishtyaitatsarvairapyanubhuuyate yuktidrishtyaa tvanirvaachyam naasadaasiiditi shruteh

इस प्रकार लौकिक दृष्टि से इसे सब लोग अनुभव करते हैं; पर युक्ति की दृष्टि से यह अनिर्वचनीय है, क्योंकि श्रुति कहती है 'न असत् था'।

In this way all men experience it from the worldly point of view; but from the point of view of reasoning it is indescribable, since scripture says 'there was no non-being'.

नासदासीद्विभातत्वान्नो सदासीच्च बाधनात्
विद्यादृष्ट्या श्रुतं तुच्छं तस्य नित्यनिवृत्तितः ॥ १२९ ॥

nāsadāsīdvibhātatvānno sadāsīcca bādhanāt
vidyādṛṣṭyā śrutaṃ tucchaṃ tasya nityanivṛttitaḥ || 129 ||

Naasadaasiidvibhaatatvaanno sadaasiichcha baadhanaat vidyaadrishtyaa shrutam tuchchham tasya nityanivrittitah

भासित होने से 'असत् नहीं था', और बाधित होने से 'सत् भी नहीं था'; विद्या की दृष्टि से वह तुच्छ है, क्योंकि उसकी नित्य निवृत्ति होती है।

Since it shines, 'there was no non-being'; since it is set aside, 'neither was there being'. From the point of view of knowledge it is a mere nothing, for it is always cancelled.

तुच्छाऽनिर्वचनीया च वास्तवी चेत्यसौ त्रिधा
ज्ञेया माया त्रिभिर्बोधैः श्रौतयौक्तिकलौकिकैः ॥ १३० ॥

tucchā'nirvacanīyā ca vāstavī cetyasau tridhā
jñeyā māyā tribhirbodhaiḥ śrautayauktikalaukikaiḥ || 130 ||

Tuchchhaa'nirvachaniiyaa cha vaastavii chetyasau tridhaa jneyaa maayaa tribhirbodhaih shrautayauktikalaukikaih

तुच्छ, अनिर्वचनीय और वास्तविक — इस प्रकार माया तीन रूपों में जानी जाती है, श्रौत, यौक्तिक और लौकिक — इन तीन बोधों से।

As a mere nothing, as indescribable, and as real — illusion is to be known in these three ways, by the three understandings of scripture, of reasoning and of the world.

अस्य सत्वमसत्त्वं च जगतो दर्शयत्यसौ
प्रसारणाच्च संकोचाद्यथा चित्रपटस्तथा ॥ १३१ ॥

asya satvamasattvaṃ ca jagato darśayatyasau
prasāraṇācca saṃkocādyathā citrapaṭastathā || 131 ||

Asya satvamasattvam cha jagato darshayatyasau prasaaranaachcha samkochaadyathaa chitrapatastathaa

फैलने और सिमटने से यह जगत् का होना और न होना दिखाती है — जैसे चित्र का पट।

By spreading out and drawing in, it shows the being and the non-being of the world — just as a painted cloth does.

अस्वतन्त्रा हि माया स्यादप्रतीतेर्विना चितिम्
स्वतन्त्रापि तथैव स्यादसंगस्यान्यथाकृतेः ॥ १३२ ॥

asvatantrā hi māyā syādapratītervinā citim
svatantrāpi tathaiva syādasaṃgasyānyathākṛteḥ || 132 ||

Asvatantraa hi maayaa syaadapratiitervinaa chitim svatantraapi tathaiva syaadasamgasyaanyathaakriteh

माया स्वतन्त्र नहीं है, क्योंकि चित् के बिना उसकी प्रतीति नहीं होती; और स्वतन्त्र भी वैसी ही है, क्योंकि वह असङ्ग को अन्यथा कर देती है।

Illusion is not independent, for without awareness it does not appear; and yet it is independent too, since it makes the unattached seem otherwise.

कूटस्थासंगमात्मानं जडत्वेन करोति सा
चिदाभासस्वरूपेण जीवेशावपि निर्ममे ॥ १३३ ॥

kūṭasthāsaṃgamātmānaṃ jaḍatvena karoti sā
cidābhāsasvarūpeṇa jīveśāvapi nirmame || 133 ||

Kuutasthaasamgamaatmaanam jadatvena karoti saa chidaabhaasasvaruupena jiiveshaavapi nirmame

वह कूटस्थ असङ्ग आत्मा को जड़ बना देती है; और चिदाभास के रूप में उसने जीव और ईश्वर को भी रच डाला।

It makes the unchanging, unattached Self seem inert; and in the form of the reflection of awareness it has fashioned both soul and Lord.

कूटस्थमनुपद्रुत्य करोति जगदादिकम्
दुर्घटैकविधायिन्यां मायायां का चमत्कृतिः ॥ १३४ ॥

kūṭasthamanupadrutya karoti jagadādikam
durghaṭaikavidhāyinyāṃ māyāyāṃ kā camatkṛtiḥ || 134 ||

Kuutasthamanupadrutya karoti jagadaadikam durghataikavidhaayinyaam maayaayaam kaa chamatkritih

कूटस्थ को बिना छेड़े ही वह जगत् आदि रच देती है; जो केवल असम्भव को ही करती है, उस माया में आश्चर्य क्या?

Without disturbing the unchanging one it makes the world and the rest; what wonder is there in an illusion whose one work is the impossible?

द्रवत्वमुदके वह्नावौष्ण्यं काठिन्यमश्मनि
मायाया दुर्घटत्वं च स्वतस्सिध्यति नान्यतः ॥ १३५ ॥

dravatvamudake vahnāvauṣṇyaṃ kāṭhinyamaśmani
māyāyā durghaṭatvaṃ ca svatassidhyati nānyataḥ || 135 ||

Dravatvamudake vahnaavaushnyam kaathinyamashmani maayaayaa durghatatvam cha svatassidhyati naanyatah

जल में द्रवता, अग्नि में उष्णता, पत्थर में कठोरता — और माया में दुर्घटता — ये स्वतः सिद्ध हैं, किसी दूसरे से नहीं।

Fluidity in water, heat in fire, hardness in stone — and in illusion the working of the impossible — these are established of themselves, not from anything else.

न वेत्ति लोको यावत्तां साक्षात्तावच्चमत्कृतिम्
धत्ते मनसि पश्चात्तु मायैषेत्युपशाम्यति ॥ १३६ ॥

na vetti loko yāvattāṃ sākṣāttāvaccamatkṛtim
dhatte manasi paścāttu māyaiṣetyupaśāmyati || 136 ||

Na vetti loko yaavattaam saakshaattaavachchamatkritim dhatte manasi pashchaattu maayaishetyupashaamyati

जब तक लोग उसे साक्षात् नहीं जानते, तब तक मन में चमत्कार रखते हैं; पर बाद में 'यह तो माया है' — ऐसा जानकर शान्त हो जाते हैं।

So long as men do not see it directly they keep wonder in their minds; but afterwards, knowing 'this is illusion', they grow calm.

प्रसरन्ति हि चोद्यानि जगद्वस्तुत्ववादिषु
न चोदनीयं मायायां तस्याश्चोद्यैकरूपतः ॥ १३७ ॥

prasaranti hi codyāni jagadvastutvavādiṣu
na codanīyaṃ māyāyāṃ tasyāścodyaikarūpataḥ || 137 ||

Prasaranti hi chodyaani jagadvastutvavaadishu na chodaniiyam maayaayaam tasyaashchodyaikaruupatah

जगत् को वस्तु मानने वालों के विरुद्ध आपत्तियाँ चलती हैं; माया में कोई आपत्ति नहीं उठाई जा सकती, क्योंकि वह स्वयं आपत्ति-रूप ही है।

Objections press hard on those who hold the world to be real; against illusion no objection can be raised, since it is objection itself in form.

चोद्येऽपि यदि चोद्यं स्यात्तच्चोद्ये चोद्यते मया
परिहार्यं ततश्चोद्यम् न पुनः प्रतिचोद्यताम् ॥ १३८ ॥

codye'pi yadi codyaṃ syāttaccodye codyate mayā
parihāryaṃ tataścodyam na punaḥ praticodyatām || 138 ||

Chodye'pi yadi chodyam syaattachchodye chodyate mayaa parihaaryam tatashchodyam na punah pratichodyataam

यदि आपत्ति पर भी आपत्ति हो, तो उस आपत्ति पर मैं फिर आपत्ति करूँगा; इसलिए आपत्ति का परिहार करो, फिर से प्रति-आपत्ति मत करो।

If there is an objection even to the objection, I shall object to that objection in turn; so remove the objection, and do not object back again.

विस्मयैकशरीराया मायायाश्चोद्यरूपतः
अन्वेष्यः परिहारोऽस्या बुद्धिमद्भिः प्रयत्नतः ॥ १३९ ॥

vismayaikaśarīrāyā māyāyāścodyarūpataḥ
anveṣyaḥ parihāro'syā buddhimadbhiḥ prayatnataḥ || 139 ||

Vismayaikashariiraayaa maayaayaashchodyaruupatah anveshyah parihaaro'syaa buddhimadbhih prayatnatah

माया का शरीर तो केवल विस्मय ही है, और वह आपत्ति-रूप है; इसलिए बुद्धिमानों को प्रयत्न से इसका परिहार ढूँढ़ना चाहिए।

Illusion is made of wonder alone and is objection in its very form; so the wise should seek its removal with effort.

मायात्वमेव निश्चेयमिति चेत्तर्हि निश्चिनु
लोकप्रसिद्धमायाया लक्षणं यत्तदीक्ष्यताम् ॥ १४० ॥

māyātvameva niśceyamiti cettarhi niścinu
lokaprasiddhamāyāyā lakṣaṇaṃ yattadīkṣyatām || 140 ||

Maayaatvameva nishcheyamiti chettarhi nishchinu lokaprasiddhamaayaayaa lakshanam yattadiikshyataam

यदि कहो कि उसका मायापन ही निश्चित करना है — तो निश्चित करो; लोक में प्रसिद्ध माया का जो लक्षण है, उसे देखो।

If you say that its being illusion must first be settled, then settle it: look at the mark of illusion as the world well knows it.

न निरूपयितुं शक्या विस्पष्टं भासते च या
सा मायेतीन्द्रजालादौ लोकाः संप्रतिपेदिरे ॥ १४१ ॥

na nirūpayituṃ śakyā vispaṣṭaṃ bhāsate ca yā
sā māyetīndrajālādau lokāḥ saṃpratipedire || 141 ||

Na niruupayitum shakyaa vispashtam bhaasate cha yaa saa maayetiindrajaalaadau lokaah sampratipedire

जो निरूपित नहीं की जा सकती और फिर भी स्पष्ट भासती है, वही माया है — इन्द्रजाल आदि में लोगों ने यही माना है।

What cannot be defined and yet shines plainly is illusion — so men have agreed in the case of conjuring and the like.

स्पष्टं भाति जगच्चेदमशक्यं तन्निरूपणम्
मायामयं जगत्तस्मादीक्षस्वापक्षपाततः ॥ १४२ ॥

spaṣṭaṃ bhāti jagaccedamaśakyaṃ tannirūpaṇam
māyāmayaṃ jagattasmādīkṣasvāpakṣapātataḥ || 142 ||

Spashtam bhaati jagachchedamashakyam tanniruupanam maayaamayam jagattasmaadiikshasvaapakshapaatatah

यह जगत् स्पष्ट भासता है और इसका निरूपण असम्भव है; इसलिए जगत् मायामय है — पक्षपात छोड़कर देखो।

This world shines plainly and cannot be defined; therefore the world is made of illusion — look at it without partiality.

निरूपयितुमारब्धे निखिलैरपि पण्डितैः
अज्ञानं पुरतस्तेषां भाति कक्षासु कासु चित् ॥ १४३ ॥

nirūpayitumārabdhe nikhilairapi paṇḍitaiḥ
ajñānaṃ puratasteṣāṃ bhāti kakṣāsu kāsu cit || 143 ||

Niruupayitumaarabdhe nikhilairapi panditaih ajnaanam puratasteshaam bhaati kakshaasu kaasu chit

सब पण्डित जब निरूपण आरम्भ करते हैं, तब किसी न किसी कक्षा में उनके सामने अज्ञान आ खड़ा होता है।

When all the learned set out to define it, at one stage or another ignorance stands before them.

देहेन्द्रियादयो भावा वीर्येणोत्पादिताः कथम्
कथं वा तत्र चैतन्यमित्युक्ते ते किमुत्तरम् ॥ १४४ ॥

dehendriyādayo bhāvā vīryeṇotpāditāḥ katham
kathaṃ vā tatra caitanyamityukte te kimuttaram || 144 ||

Dehendriyaadayo bhaavaa viiryenotpaaditaah katham katham vaa tatra chaitanyamityukte te kimuttaram

'देह, इन्द्रिय आदि भाव वीर्य से कैसे उत्पन्न हुए? और उनमें चैतन्य कैसे आया?' — यह पूछे जाने पर उनके पास क्या उत्तर है?

'How did body, organs and the rest arise from seed? and how did awareness come to be in them?' — when this is asked, what answer have they?

वीर्यस्यैष स्वभावश्चेत्कथं तद्विदितं त्वया
अन्वयव्यतिरेकौ यौ भग्नौ तौ वन्ध्यवीर्यतः ॥ १४५ ॥

vīryasyaiṣa svabhāvaścetkathaṃ tadviditaṃ tvayā
anvayavyatirekau yau bhagnau tau vandhyavīryataḥ || 145 ||

Viiryasyaisha svabhaavashchetkatham tadviditam tvayaa anvayavyatirekau yau bhagnau tau vandhyaviiryatah

यदि कहो कि यह वीर्य का स्वभाव है — तो यह तुमने कैसे जाना? जो अन्वय और व्यतिरेक हैं, वे तो बन्ध्य वीर्य से भग्न हो जाते हैं।

If you say this is the nature of seed, how did you know it? The rules of presence and absence are broken by seed that is barren.

न जानामि किमप्येतदित्यंते शरणं तव
अत एव महान्तोऽस्य प्रवदन्तीन्द्रजालताम् ॥ १४६ ॥

na jānāmi kimapyetadityaṃte śaraṇaṃ tava
ata eva mahānto'sya pravadantīndrajālatām || 146 ||

Na jaanaami kimapyetadityamte sharanam tava ata eva mahaanto'sya pravadantiindrajaalataam

'मैं इसे कुछ भी नहीं जानता' — अन्त में यही तुम्हारी शरण है; इसीलिए महापुरुष इसे इन्द्रजाल कहते हैं।

'I know nothing at all of this' — this is your refuge in the end; and that is why the great call it a conjuring trick.

एतस्मात्किमिवेन्द्रजालमपरं यद्गर्भवासस्थितम्
रेतश्चेतति हस्तमस्तकपदप्रोद्भूतनानांकुरम्
पर्यायेण शिशुत्वयौवनजरावेषैरनेकैर्वृतम्
पश्यत्यत्ति शृणोति जिघ्रति तथा गच्छत्यथागच्छति ॥ १४७ ॥

etasmātkimivendrajālamaparaṃ yadgarbhavāsasthitam
retaścetati hastamastakapadaprodbhūtanānāṃkuram
paryāyeṇa śiśutvayauvanajarāveṣairanekairvṛtam
paśyatyatti śṛṇoti jighrati tathā gacchatyathāgacchati || 147 ||

Etasmaatkimivendrajaalamaparam yadgarbhavaasasthitam retashchetati hastamastakapadaprodbhuutanaanaamkuram paryaayena shishutvayauvanajaraaveshairanekairvritam pashyatyatti shrinoti jighrati tathaa gachchhatyathaagachchhati

इससे बढ़कर और कौन-सा इन्द्रजाल है कि गर्भ में स्थित वीर्य चेतन हो जाता है, और उससे हाथ, सिर और पैर आदि अनेक अंकुर निकल आते हैं; वह क्रमशः बालपन, यौवन और बुढ़ापे के अनेक वेषों से ढँक जाता है; और देखता है, खाता है, सुनता है, सूँघता है, तथा जाता है और आता है।

What greater conjuring than this — that the seed lying in the womb becomes aware, and from it spring the many shoots of hand, head and foot; that it is clothed in turn in the many guises of childhood, youth and age; and that it sees, eats, hears, smells, and goes and comes.

देहवद्वटधानादौ सुविचार्य विलोक्यताम्
क्व धानाः कुत्र वा वृक्षस्तस्मान्मायेति निश्चिनु ॥ १४८ ॥

dehavadvaṭadhānādau suvicārya vilokyatām
kva dhānāḥ kutra vā vṛkṣastasmānmāyeti niścinu || 148 ||

Dehavadvatadhaanaadau suvichaarya vilokyataam kva dhaanaah kutra vaa vrikshastasmaanmaayeti nishchinu

देह की तरह वट के बीज आदि में भी भलीभाँति विचार करके देखो — बीज कहाँ, और वृक्ष कहाँ? इसलिए 'माया है' ऐसा निश्चय करो।

As with the body, look carefully at the seed of the banyan and the like — where is the seed and where the tree? So settle it that this is illusion.

निरुक्तावभिमानं ये दधते तार्किकादयः
हर्षमिश्रादिभिस्ते तु खंडनादौ सुशिक्षिताः ॥ १४९ ॥

niruktāvabhimānaṃ ye dadhate tārkikādayaḥ
harṣamiśrādibhiste tu khaṃḍanādau suśikṣitāḥ || 149 ||

Niruktaavabhimaanam ye dadhate taarkikaadayah harshamishraadibhiste tu khamdanaadau sushikshitaah

जो तार्किक आदि निरूपण करने का अभिमान रखते हैं, उन्हें हर्षमिश्र आदि ने खण्डन आदि में भलीभाँति शिक्षा दे दी है।

The logicians and the rest who pride themselves on defining have been well schooled by Harṣa and others in the works of refutation.

अचिन्त्याः खलु ये भावा न तांस्तर्केषु योजयेत्
अचिन्त्यरचनारूपं मनसाऽपि जगत्खलु ॥ १५० ॥

acintyāḥ khalu ye bhāvā na tāṃstarkeṣu yojayet
acintyaracanārūpaṃ manasā'pi jagatkhalu || 150 ||

Achintyaah khalu ye bhaavaa na taamstarkeshu yojayet achintyarachanaaruupam manasaa'pi jagatkhalu

जो भाव अचिन्त्य हैं उन्हें तर्कों में नहीं जोड़ना चाहिए; और जगत् की रचना तो मन से भी अचिन्त्य है।

Things that are unthinkable should not be brought under arguments; and the making of the world is unthinkable even by the mind.

अचिन्त्यरचनाशक्तिबीजं मायेति निश्चिनु
मायाबीजं तदेवैकं सुषुप्तावनुभूयते ॥ १५१ ॥

acintyaracanāśaktibījaṃ māyeti niścinu
māyābījaṃ tadevaikaṃ suṣuptāvanubhūyate || 151 ||

Achintyarachanaashaktibiijam maayeti nishchinu maayaabiijam tadevaikam sushuptaavanubhuuyate

अचिन्त्य रचना की शक्ति का बीज माया है — ऐसा निश्चय करो; और वही एक माया-बीज सुषुप्ति में अनुभव किया जाता है।

Settle it that illusion is the seed of the power of unthinkable making; and that one seed of illusion is experienced in deep sleep.

जाग्रत्स्वप्नजगत्तत्र लीनं बीज इव द्रुमः
तस्मादशेषजगतो वासनास्तत्र संस्थिताः ॥ १५२ ॥

jāgratsvapnajagattatra līnaṃ bīja iva drumaḥ
tasmādaśeṣajagato vāsanāstatra saṃsthitāḥ || 152 ||

Jaagratsvapnajagattatra liinam biija iva drumah tasmaadasheshajagato vaasanaastatra samsthitaah

जाग्रत् और स्वप्न का जगत् उसी में लीन रहता है, जैसे बीज में वृक्ष; इसलिए समस्त जगत् की वासनाएँ वहीं स्थित रहती हैं।

The world of waking and of dream lies dissolved in it as the tree lies in the seed; so the latent tendencies of the whole world rest there.

या बुद्धिवासनास्तासु चैतन्यं प्रतिबिंबति
मेघाकाशवदस्पष्टचिदाभासोऽनुमीयताम् ॥ १५३ ॥

yā buddhivāsanāstāsu caitanyaṃ pratibiṃbati
meghākāśavadaspaṣṭacidābhāso'numīyatām || 153 ||

Yaa buddhivaasanaastaasu chaitanyam pratibimbati meghaakaashavadaspashtachidaabhaaso'numiiyataam

जो बुद्धि की वासनाएँ हैं, उनमें चैतन्य प्रतिबिम्बित होता है; मेघाकाश की तरह उस अस्पष्ट चिदाभास का अनुमान करना चाहिए।

Awareness is reflected in the latent tendencies of the understanding; that dim reflection of awareness is to be inferred, like the space in cloud.

साभासमेव तद्बीजं धीरूपेण प्ररोहति
अतो बुद्धौ चिदाभासो विस्पष्टं प्रतिभासते ॥ १५४ ॥

sābhāsameva tadbījaṃ dhīrūpeṇa prarohati
ato buddhau cidābhāso vispaṣṭaṃ pratibhāsate || 154 ||

Saabhaasameva tadbiijam dhiiruupena prarohati ato buddhau chidaabhaaso vispashtam pratibhaasate

वही आभास-सहित बीज बुद्धि के रूप में अंकुरित होता है; इसीलिए बुद्धि में चिदाभास स्पष्ट रूप से भासित होता है।

That seed, together with the reflection, sprouts in the form of the understanding; and so in the understanding the reflection of awareness shines plainly.

मायाभासेन जीवेशौ करोतीति श्रुतौ श्रुतम्
मेघाकाशजलाकाशाविव तौ सुव्यवस्थितौ ॥ १५५ ॥

māyābhāsena jīveśau karotīti śrutau śrutam
meghākāśajalākāśāviva tau suvyavasthitau || 155 ||

Maayaabhaasena jiiveshau karotiiti shrutau shrutam meghaakaashajalaakaashaaviva tau suvyavasthitau

'माया के आभास से वह जीव और ईश्वर को बनाता है' — ऐसा श्रुति में सुना गया; वे दोनों मेघाकाश और जलाकाश की तरह भलीभाँति व्यवस्थित हैं।

'By the reflection in illusion he makes soul and Lord' — so it is heard in scripture; the two stand well ordered, like the space in cloud and the space in water.

मेघवद्वर्तते माया मेघस्थिततुषारवत्
धीवासनाश्चिदाभासस्तुषारस्थखवत् स्थितः ॥ १५६ ॥

meghavadvartate māyā meghasthitatuṣāravat
dhīvāsanāścidābhāsastuṣārasthakhavat sthitaḥ || 156 ||

Meghavadvartate maayaa meghasthitatushaaravat dhiivaasanaashchidaabhaasastushaarasthakhavat sthitah

माया मेघ की तरह है; बुद्धि की वासनाएँ मेघ में ठहरे तुषार की तरह; और चिदाभास तुषार में पड़े आकाश की तरह स्थित है।

Illusion is like the cloud; the latent tendencies of the understanding are like the mist held in the cloud; and the reflection of awareness stands like the sky within the mist.

मायाधीनश्चिदाभासः श्रुतो मायी महेश्वरः
अन्तर्यामी च सर्वज्ञो जगद्योनिस्स एव हि ॥ १५७ ॥

māyādhīnaścidābhāsaḥ śruto māyī maheśvaraḥ
antaryāmī ca sarvajño jagadyonissa eva hi || 157 ||

Maayaadhiinashchidaabhaasah shruto maayii maheshvarah antaryaamii cha sarvajno jagadyonissa eva hi

माया के अधीन चिदाभास ही श्रुति में 'मायी महेश्वर' कहा गया है; वही अन्तर्यामी, सर्वज्ञ और जगत् की योनि है।

The reflection of awareness that is subject to illusion is what scripture calls the great Lord, the wielder of illusion; he alone is the inner ruler, the all-knowing, the womb of the world.

सौषुप्तमानंदमयं प्रक्रम्यैवं श्रुतिर्जगौ
एष सर्वेश्वर इति सोयम् वेदोक्त ईश्वरः ॥ १५८ ॥

sauṣuptamānaṃdamayaṃ prakramyaivaṃ śrutirjagau
eṣa sarveśvara iti soyam vedokta īśvaraḥ || 158 ||

Saushuptamaanamdamayam prakramyaivam shrutirjagau esha sarveshvara iti soyam vedokta iishvarah

सुषुप्ति के आनन्दमय से आरम्भ करके श्रुति ने यही गाया — 'यह सबका ईश्वर है'; यही वेद में कहा हुआ ईश्वर है।

Beginning from the sheath of bliss in deep sleep, scripture sang, 'this is the Lord of all'; and this is the Lord the Veda speaks of.

सर्वज्ञत्वादिके तस्य नैव विप्रतिपद्यताम्
श्रौतार्थस्यावितर्क्यत्वान्मायायां सर्वसंभवात् ॥ १५९ ॥

sarvajñatvādike tasya naiva vipratipadyatām
śrautārthasyāvitarkyatvānmāyāyāṃ sarvasaṃbhavāt || 159 ||

Sarvajnatvaadike tasya naiva vipratipadyataam shrautaarthasyaavitarkyatvaanmaayaayaam sarvasambhavaat

उसके सर्वज्ञत्व आदि में विवाद नहीं करना चाहिए, क्योंकि श्रुति का अर्थ तर्क का विषय नहीं है और माया में सब कुछ सम्भव है।

One should not dispute his all-knowingness and the rest, for the meaning of scripture is not a matter for argument, and in illusion everything is possible.

अयं यत्सृजते विश्वं तदन्यथयितुं पुमान्
न कोऽपि शक्तस्तेनायं सर्वेश्वर इतीरितः ॥ १६० ॥

ayaṃ yatsṛjate viśvaṃ tadanyathayituṃ pumān
na ko'pi śaktastenāyaṃ sarveśvara itīritaḥ || 160 ||

Ayam yatsrijate vishvam tadanyathayitum pumaan na ko'pi shaktastenaayam sarveshvara itiiritah

यह जिस विश्व की सृष्टि करता है, उसे अन्यथा करने में कोई पुरुष समर्थ नहीं; इसीलिए यह 'सर्वेश्वर' कहा गया है।

No man is able to make otherwise the world that he creates; and therefore he is called the Lord of all.

अशेषप्राणिबुद्धीनां वासनास्तत्र संस्थिताः
ताभिः क्रोडीकृतं सर्वं तेन सर्वज्ञ ईरितः ॥ १६१ ॥

aśeṣaprāṇibuddhīnāṃ vāsanāstatra saṃsthitāḥ
tābhiḥ kroḍīkṛtaṃ sarvaṃ tena sarvajña īritaḥ || 161 ||

Asheshapraanibuddhiinaam vaasanaastatra samsthitaah taabhih krodiikritam sarvam tena sarvajna iiritah

समस्त प्राणियों की बुद्धियों की वासनाएँ उसी में स्थित हैं; उनसे सब कुछ उसकी गोद में है — इसीलिए वह 'सर्वज्ञ' कहा गया है।

The latent tendencies of the minds of all living beings rest in him; by them all is gathered into his lap — and therefore he is called all-knowing.

वासनानां परोक्षत्वात्सर्वज्ञत्वं न हीक्ष्यते
सर्वबुद्धिषु तद्दृष्ट्वा वासनास्वनुमीयताम् ॥ १६२ ॥

vāsanānāṃ parokṣatvātsarvajñatvaṃ na hīkṣyate
sarvabuddhiṣu taddṛṣṭvā vāsanāsvanumīyatām || 162 ||

Vaasanaanaam parokshatvaatsarvajnatvam na hiikshyate sarvabuddhishu taddrishtvaa vaasanaasvanumiiyataam

वासनाओं के परोक्ष होने से उसका सर्वज्ञत्व प्रत्यक्ष नहीं दिखता; सब बुद्धियों में उसे देखकर वासनाओं में उसका अनुमान करना चाहिए।

Since the tendencies are unseen, his all-knowingness is not perceived; seeing it in all minds, let it be inferred in the tendencies.

विज्ञानमयमुख्येषु कोशेष्वन्यत्र चैव हि
अन्तस्तिष्ठन्यमयति तेनान्तर्यामितां व्रजेत् ॥ १६३ ॥

vijñānamayamukhyeṣu kośeṣvanyatra caiva hi
antastiṣṭhanyamayati tenāntaryāmitāṃ vrajet || 163 ||

Vijnaanamayamukhyeshu kosheshvanyatra chaiva hi antastishthanyamayati tenaantaryaamitaam vrajet

विज्ञानमय आदि मुख्य कोशों में और अन्यत्र भी वह भीतर रहकर नियमन करता है; इसलिए उसे 'अन्तर्यामी' कहा जाता है।

In the chief sheaths, that of understanding and the rest, and elsewhere too, he dwells within and governs; therefore he is the inner ruler.

बुद्धौ तिष्ठन्नन्तरोऽस्या धियाऽनीक्ष्यश्च धीवपुः
धियमंतर्यमयतीत्येवं वेदेन घोषितम् ॥ १६४ ॥

buddhau tiṣṭhannantaro'syā dhiyā'nīkṣyaśca dhīvapuḥ
dhiyamaṃtaryamayatītyevaṃ vedena ghoṣitam || 164 ||

Buddhau tishthannantaro'syaa dhiyaa'niikshyashcha dhiivapuh dhiyamamtaryamayatiityevam vedena ghoshitam

बुद्धि में रहते हुए भी वह उससे भीतर है, बुद्धि से नहीं देखा जाता, और बुद्धि ही उसका शरीर है; वह बुद्धि का भीतर से नियमन करता है — ऐसा वेद ने घोषित किया।

Dwelling in the understanding he is within it, is not seen by it, and has it for his body; he governs the understanding from within — so the Veda has proclaimed.

तन्तुः पटे स्थितो यद्वदुपादानतया तथा
सर्वोपादानरूपत्वात्सर्वत्रायमवस्थितः ॥ १६५ ॥

tantuḥ paṭe sthito yadvadupādānatayā tathā
sarvopādānarūpatvātsarvatrāyamavasthitaḥ || 165 ||

Tantuh pate sthito yadvadupaadaanatayaa tathaa sarvopaadaanaruupatvaatsarvatraayamavasthitah

जैसे तन्तु उपादान-रूप से पट में स्थित है, वैसे ही सबका उपादान होने से यह सर्वत्र स्थित है।

As the thread is present in the cloth as its material, so, being the material of all, he is present everywhere.

पटादप्यान्तरस्तन्तुस्तन्तोरप्यंशुरान्तरः
आन्तरत्वस्य विश्रान्तिर्यत्रासावनुमीयताम् ॥ १६६ ॥

paṭādapyāntarastantustantorapyaṃśurāntaraḥ
āntaratvasya viśrāntiryatrāsāvanumīyatām || 166 ||

Pataadapyaantarastantustantorapyamshuraantarah aantaratvasya vishraantiryatraasaavanumiiyataam

पट से भी भीतर तन्तु है, तन्तु से भी भीतर अंशु; जहाँ इस आन्तरता का विश्राम हो, वहीं इसका अनुमान करना चाहिए।

Within the cloth is the thread, and within the thread the fibre; where this inwardness comes to rest, there he is to be inferred.

द्वित्रान्तरत्वकक्षाणां दर्शनेऽप्ययमान्तरः
न वीक्ष्यते ततो युक्तिश्रुतिभ्यामेव निर्णयः ॥ १६७ ॥

dvitrāntaratvakakṣāṇāṃ darśane'pyayamāntaraḥ
na vīkṣyate tato yuktiśrutibhyāmeva nirṇayaḥ || 167 ||

Dvitraantaratvakakshaanaam darshane'pyayamaantarah na viikshyate tato yuktishrutibhyaameva nirnayah

दो-तीन आन्तरता की कक्षाएँ दिखाई देने पर भी यह नहीं देखा जाता; इसलिए युक्ति और श्रुति से ही इसका निर्णय होता है।

Though two or three stages of inwardness are seen, he is not seen; therefore the decision about him comes from reasoning and scripture alone.

पटरूपेण संस्थानात्पटस्तन्तोर्वपुर्यथा
सर्वरूपेण संस्थानात्सर्वमस्य वपुस्तथा ॥ १६८ ॥

paṭarūpeṇa saṃsthānātpaṭastantorvapuryathā
sarvarūpeṇa saṃsthānātsarvamasya vapustathā || 168 ||

Pataruupena samsthaanaatpatastantorvapuryathaa sarvaruupena samsthaanaatsarvamasya vapustathaa

जैसे पट के रूप में स्थित होने से पट तन्तु का शरीर है, वैसे ही सब रूपों में स्थित होने से यह सब इसका शरीर है।

As the cloth, standing in the form of cloth, is the body of the thread, so, standing in all forms, all this is his body.

तन्तोः संकोचविस्तारचलनादौ पटस्तथा
अवश्यमेव भवति न स्वातन्त्र्यं पटे मनाक् ॥ १६९ ॥

tantoḥ saṃkocavistāracalanādau paṭastathā
avaśyameva bhavati na svātantryaṃ paṭe manāk || 169 ||

Tantoh samkochavistaarachalanaadau patastathaa avashyameva bhavati na svaatantryam pate manaak

जैसे तन्तु के सिकुड़ने, फैलने और हिलने आदि में पट भी अवश्य वैसा ही होता है, और पट में तनिक भी स्वतन्त्रता नहीं होती —

As, when the thread contracts, stretches or moves, the cloth must do the same, and the cloth has not the least independence of its own —

तथान्तर्याम्ययं यत्र यया वासनया यथा
विक्रीयते तथावश्यं भवत्येव न संशयः ॥ १७० ॥

tathāntaryāmyayaṃ yatra yayā vāsanayā yathā
vikrīyate tathāvaśyaṃ bhavatyeva na saṃśayaḥ || 170 ||

Tathaantaryaamyayam yatra yayaa vaasanayaa yathaa vikriiyate tathaavashyam bhavatyeva na samshayah

वैसे ही यह अन्तर्यामी जहाँ, जिस वासना से, जिस प्रकार विकृत होता है, वैसा ही अवश्य होता है; इसमें सन्देह नहीं।

so this inner ruler, wherever, by whatever tendency and in whatever manner he is modified, it happens just so of necessity; of this there is no doubt.

ईश्वरः सर्वभूतानां हृद्देशेऽर्जुन तिष्ठति
भ्रामयन्सर्वभूतानि यन्त्रारूढानि मायया ॥ १७१ ॥

īśvaraḥ sarvabhūtānāṃ hṛddeśe'rjuna tiṣṭhati
bhrāmayansarvabhūtāni yantrārūḍhāni māyayā || 171 ||

Iishvarah sarvabhuutaanaam hriddeshe'rjuna tishthati bhraamayansarvabhuutaani yantraaruudhaani maayayaa

'हे अर्जुन, ईश्वर सब भूतों के हृदय-देश में स्थित है, और यन्त्र पर चढ़े हुए सब भूतों को माया से घुमाता है।'

'The Lord, Arjuna, dwells in the heart of all beings, and by his illusion whirls all beings mounted upon a machine.'

सर्वभूतानि विज्ञानमयास्ते हृदये स्थिताः
तदुपादानभूतेशस्तत्र विक्रियते खलु ॥ १७२ ॥

sarvabhūtāni vijñānamayāste hṛdaye sthitāḥ
tadupādānabhūteśastatra vikriyate khalu || 172 ||

Sarvabhuutaani vijnaanamayaaste hridaye sthitaah tadupaadaanabhuuteshastatra vikriyate khalu

सब भूत विज्ञानमय हैं और हृदय में स्थित हैं; उनका उपादान ईश्वर है, और वहीं वह विकृत होता है।

All beings are of the nature of understanding and dwell in the heart; the Lord is their material, and it is there that he is modified.

देहादिपंजरं यन्त्रं तदारोहोऽभिमानिता
विहितप्रतिषिद्धेषु प्रवृत्तिर्भ्रमणं भवेत् ॥ १७३ ॥

dehādipaṃjaraṃ yantraṃ tadāroho'bhimānitā
vihitapratiṣiddheṣu pravṛttirbhramaṇaṃ bhavet || 173 ||

Dehaadipamjaram yantram tadaaroho'bhimaanitaa vihitapratishiddheshu pravrittirbhramanam bhavet

देह आदि का पिंजरा यन्त्र है, उस पर चढ़ना अभिमान है; और विहित तथा निषिद्ध कर्मों में प्रवृत्ति ही घूमना है।

The cage of body and the rest is the machine; mounting it is self-identification; and moving among things enjoined and forbidden is the whirling.

विज्ञानमयरूपेण तत्प्रवृत्तिस्वरूपतः
स्वशक्त्येशो विक्रियते मायया भ्रामणं हि तत् ॥ १७४ ॥

vijñānamayarūpeṇa tatpravṛttisvarūpataḥ
svaśaktyeśo vikriyate māyayā bhrāmaṇaṃ hi tat || 174 ||

Vijnaanamayaruupena tatpravrittisvaruupatah svashaktyesho vikriyate maayayaa bhraamanam hi tat

विज्ञानमय के रूप में और उसकी प्रवृत्ति के रूप में ईश्वर अपनी शक्ति से विकृत होता है; माया से यही घुमाना है।

In the form of the sheath of understanding and of its activity the Lord is modified by his own power; and that whirling is by illusion.

अन्तर्यमयतीत्युक्त्यायमेवार्थः श्रुतौ श्रुतः
पृथिव्यादिषु सर्वत्र न्यायोऽयं योज्यतां धिया ॥ १७५ ॥

antaryamayatītyuktyāyamevārthaḥ śrutau śrutaḥ
pṛthivyādiṣu sarvatra nyāyo'yaṃ yojyatāṃ dhiyā || 175 ||

Antaryamayatiityuktyaayamevaarthah shrutau shrutah prithivyaadishu sarvatra nyaayo'yam yojyataam dhiyaa

'भीतर से नियमन करता है' — इस कथन से श्रुति में यही अर्थ सुना गया है; पृथ्वी आदि सब जगह इस न्याय को बुद्धि से लगाना चाहिए।

'He governs from within' — this is the meaning heard in scripture; this rule is to be applied by the understanding to earth and all the rest.

जानामि धर्मम् न च मे प्रवृत्तिः जानाम्यधर्मम् न च मे निवृत्तिः
केनापि देवेन हृदि स्थितेन यथा नियुक्तोऽस्मि तथा करोमि ॥ १७६ ॥

jānāmi dharmam na ca me pravṛttiḥ jānāmyadharmam na ca me nivṛttiḥ
kenāpi devena hṛdi sthitena yathā niyukto'smi tathā karomi || 176 ||

Jaanaami dharmam na cha me pravrittih jaanaamyadharmam na cha me nivrittih kenaapi devena hridi sthitena yathaa niyukto'smi tathaa karomi

'मैं धर्म जानता हूँ, पर उसमें मेरी प्रवृत्ति नहीं; मैं अधर्म जानता हूँ, पर उससे मेरी निवृत्ति नहीं; हृदय में स्थित किसी देव के द्वारा जैसा नियुक्त हूँ, वैसा ही करता हूँ।'

'I know what is right, yet I do not turn to it; I know what is wrong, yet I do not turn from it; as I am appointed by some god seated in my heart, so do I act.'

नार्थः पुरुषकारेणेत्येव मा शंक्यताम् यतः
ईशः पुरुषकारस्वरूपेणापि विवर्तते ॥ १७७ ॥

nārthaḥ puruṣakāreṇetyeva mā śaṃkyatām yataḥ
īśaḥ puruṣakārasvarūpeṇāpi vivartate || 177 ||

Naarthah purushakaarenetyeva maa shamkyataam yatah iishah purushakaarasvaruupenaapi vivartate

'तो फिर पुरुषार्थ का कोई प्रयोजन नहीं' — ऐसी शङ्का न करो; क्योंकि ईश्वर पुरुषार्थ के रूप में भी विवर्तित होता है।

Do not suspect that human effort is therefore of no use; for the Lord appears in the form of human effort as well.

ईदृग्बोधेनेश्वरस्य प्रवृत्तिर्मैव वार्यताम्
तथापीशस्य बोधेन स्वात्मासंगत्वधीजनिः ॥ १७८ ॥

īdṛgbodheneśvarasya pravṛttirmaiva vāryatām
tathāpīśasya bodhena svātmāsaṃgatvadhījaniḥ || 178 ||

Iidrigbodheneshvarasya pravrittirmaiva vaaryataam tathaapiishasya bodhena svaatmaasamgatvadhiijanih

ऐसा बोध होने पर ईश्वर की प्रवृत्ति को रोका न जाए; फिर भी ईश्वर के बोध से अपने आत्मा की असङ्गता की बुद्धि उत्पन्न होती है।

With such knowledge let the Lord's working not be hindered; yet by the knowledge of the Lord there arises the conviction of one's own Self's unattachedness.

तावता मुक्तिरित्याहुः श्रुतयः स्मृतयस्तथा
श्रुतिस्मृती ममैवाज्ञे इत्यपीश्वरभाषितम् ॥ १७९ ॥

tāvatā muktirityāhuḥ śrutayaḥ smṛtayastathā
śrutismṛtī mamaivājñe ityapīśvarabhāṣitam || 179 ||

Taavataa muktirityaahuh shrutayah smritayastathaa shrutismritii mamaivaajne ityapiishvarabhaashitam

उतने से ही मुक्ति है — ऐसा श्रुतियाँ और स्मृतियाँ कहती हैं; और 'श्रुति और स्मृति मेरी ही आज्ञा हैं' — यह भी ईश्वर ने कहा है।

By that alone comes release — so say the scriptures and the codes; and 'scripture and code are my own command' is also the Lord's word.

आज्ञाया भीतिहेतुत्वं भीषास्मादिति हि श्रुतम्
सर्वेश्वरत्वमेतत्स्यादन्तर्यामित्वतः पृथक् ॥ १८० ॥

ājñāyā bhītihetutvaṃ bhīṣāsmāditi hi śrutam
sarveśvaratvametatsyādantaryāmitvataḥ pṛthak || 180 ||

Aajnaayaa bhiitihetutvam bhiishaasmaaditi hi shrutam sarveshvaratvametatsyaadantaryaamitvatah prithak

आज्ञा का भय का कारण होना 'इसके भय से' — इस प्रकार सुना गया है; यह सर्वेश्वरता अन्तर्यामिता से अलग है।

That his command is the cause of fear is heard in 'from fear of him'; this lordship over all is distinct from his being the inner ruler.

एतस्य वा अक्षरस्य प्रशासन इति श्रुतिः
अन्तः प्रविष्टः शास्तायं जनानामिति च श्रुतिः ॥ १८१ ॥

etasya vā akṣarasya praśāsana iti śrutiḥ
antaḥ praviṣṭaḥ śāstāyaṃ janānāmiti ca śrutiḥ || 181 ||

Etasya vaa aksharasya prashaasana iti shrutih antah pravishtah shaastaayam janaanaamiti cha shrutih

'इस अक्षर के शासन में' — यह श्रुति है; और 'भीतर प्रविष्ट होकर यह मनुष्यों का शासक है' — यह भी श्रुति है।

'At the command of this imperishable one' — so says scripture; and 'having entered within, he is the ruler of men' is scripture too.

जगद्योनिर्भवेदेष प्रभवाप्ययकृद्यतः
आविर्भावतिरोभावावुत्पत्तिप्रलयौ मतौ ॥ १८२ ॥

jagadyonirbhavedeṣa prabhavāpyayakṛdyataḥ
āvirbhāvatirobhāvāvutpattipralayau matau || 182 ||

Jagadyonirbhavedesha prabhavaapyayakridyatah aavirbhaavatirobhaavaavutpattipralayau matau

यही जगत् की योनि है, क्योंकि यही उत्पत्ति और प्रलय करता है; आविर्भाव और तिरोभाव ही उत्पत्ति और प्रलय माने गए हैं।

He is the womb of the world, since he brings forth and withdraws it; appearing and disappearing are held to be its birth and its dissolution.

आविर्भावयति स्वस्मिन्विलीनं सकलं जगत्
प्राणिकर्मवशादेष पटो यद्वत्प्रसारितः ॥ १८३ ॥

āvirbhāvayati svasminvilīnaṃ sakalaṃ jagat
prāṇikarmavaśādeṣa paṭo yadvatprasāritaḥ || 183 ||

Aavirbhaavayati svasminviliinam sakalam jagat praanikarmavashaadesha pato yadvatprasaaritah

प्राणियों के कर्म के वश से यह अपने में लीन समस्त जगत् को प्रकट कर देता है — जैसे फैलाया हुआ पट।

By the force of the deeds of living beings he makes manifest the whole world that lay dissolved in him — like a cloth spread out.

पुनस्तिरोभावयति स्वात्मन्येवाखिलं जगत्
प्राणिकर्मक्षयवशात्संकोचितपटो यथा ॥ १८४ ॥

punastirobhāvayati svātmanyevākhilaṃ jagat
prāṇikarmakṣayavaśātsaṃkocitapaṭo yathā || 184 ||

Punastirobhaavayati svaatmanyevaakhilam jagat praanikarmakshayavashaatsamkochitapato yathaa

प्राणियों के कर्म के क्षय से वह फिर सारे जगत् को अपने ही में छिपा लेता है — जैसे समेटा हुआ पट।

When the deeds of living beings are spent he hides the whole world again in himself — like a cloth drawn in.

रात्रिघस्रौ सुप्तिबोधावुन्मीलननिमीलने
तूष्णींभावमनोराज्ये इव सृष्टिलयाविमौ ॥ १८५ ॥

rātrighasrau suptibodhāvunmīlananimīlane
tūṣṇīṃbhāvamanorājye iva sṛṣṭilayāvimau || 185 ||

Raatrighasrau suptibodhaavunmiilananimiilane tuushniimbhaavamanoraajye iva srishtilayaavimau

रात और दिन, सुप्ति और जागरण, आँख का खुलना और मुँदना, तथा मौन और मनोराज्य — इन्हीं की तरह ये सृष्टि और प्रलय हैं।

Night and day, sleep and waking, the closing and opening of the eyes, silence and day-dreaming — like these are this creation and this dissolution.

आविर्भावतिरोभावशक्तिमत्वेन हेतुना
आरंभपरिणामादिचोद्यानां नात्रसंभवः ॥ १८६ ॥

āvirbhāvatirobhāvaśaktimatvena hetunā
āraṃbhapariṇāmādicodyānāṃ nātrasaṃbhavaḥ || 186 ||

Aavirbhaavatirobhaavashaktimatvena hetunaa aarambhaparinaamaadichodyaanaam naatrasambhavah

आविर्भाव और तिरोभाव की शक्ति वाला होने के कारण यहाँ आरम्भवाद, परिणामवाद आदि की आपत्तियाँ सम्भव नहीं हैं।

Since he has the power of making appear and disappear, the objections of the doctrines of beginning, of transformation and the rest do not arise here.

अचेतनानां हेतुः स्याज्जाड्यांशेनेश्वरस्तथा
चिदाभासांशतस्त्वेष जीवानां कारणं भवेत् ॥ १८७ ॥

acetanānāṃ hetuḥ syājjāḍyāṃśeneśvarastathā
cidābhāsāṃśatastveṣa jīvānāṃ kāraṇaṃ bhavet || 187 ||

Achetanaanaam hetuh syaajjaadyaamsheneshvarastathaa chidaabhaasaamshatastvesha jiivaanaam kaaranam bhavet

जड़ता के अंश से ईश्वर अचेतनों का कारण होता है; और चिदाभास के अंश से वही जीवों का कारण होता है।

By the portion of inertness the Lord is the cause of insentient things; and by the portion that is the reflection of awareness he is the cause of souls.

तमःप्रधानः क्षेत्राणां चित्प्रधानश्चिदात्मनाम्
परः कारणतामेति भावनाज्ञानकर्मभिः ॥ १८८ ॥

tamaḥpradhānaḥ kṣetrāṇāṃ citpradhānaścidātmanām
paraḥ kāraṇatāmeti bhāvanājñānakarmabhiḥ || 188 ||

Tamahpradhaanah kshetraanaam chitpradhaanashchidaatmanaam parah kaaranataameti bhaavanaajnaanakarmabhih

'तम की प्रधानता से वह क्षेत्रों का, और चित् की प्रधानता से चेतनों का — भावना, ज्ञान और कर्म के द्वारा — कारण होता है।'

'With darkness predominant he becomes the cause of fields, and with awareness predominant of conscious beings, through imagining, knowing and acting.'

इति वार्तिककारेण जडचेतनहेतुता
परमात्मन एवोक्ता नेश्वरस्येति चेच्छृणु ॥ १८९ ॥

iti vārtikakāreṇa jaḍacetanahetutā
paramātmana evoktā neśvarasyeti cecchṛṇu || 189 ||

Iti vaartikakaarena jadachetanahetutaa paramaatmana evoktaa neshvarasyeti chechchhrinu

'इस प्रकार वार्तिककार ने जड़ और चेतन का कारण होना परमात्मा का ही कहा है, ईश्वर का नहीं' — यदि ऐसा कहो तो सुनो।

'Thus the author of the gloss has spoken of the causality of insentient and sentient as belonging to the supreme Self and not to the Lord' — if you say so, then listen.

अन्योन्याध्यासमत्रापि जीवकूटस्थयोरिव
ईश्वरब्रह्मणोस्सिद्धं कृत्वा ब्रूते सुरेश्वरः ॥ १९० ॥

anyonyādhyāsamatrāpi jīvakūṭasthayoriva
īśvarabrahmaṇossiddhaṃ kṛtvā brūte sureśvaraḥ || 190 ||

Anyonyaadhyaasamatraapi jiivakuutasthayoriva iishvarabrahmanossiddham kritvaa bruute sureshvarah

जैसे जीव और कूटस्थ का, वैसे ही यहाँ भी ईश्वर और ब्रह्म का अन्योन्याध्यास सिद्ध मानकर सुरेश्वर ने यह कहा है।

Taking the mutual superimposition of the Lord and Brahman to be established here, as it is between soul and the unchanging one, Sureśvara has said this.

सत्यं ज्ञानमनन्तं यद्ब्रह्म तस्मात्समुत्थिताः
खं वाय्वग्निजलोर्व्योषध्यन्नदेहा इति श्रुतिः ॥ १९१ ॥

satyaṃ jñānamanantaṃ yadbrahma tasmātsamutthitāḥ
khaṃ vāyvagnijalorvyoṣadhyannadehā iti śrutiḥ || 191 ||

Satyam jnaanamanantam yadbrahma tasmaatsamutthitaah kham vaayvagnijalorvyoshadhyannadehaa iti shrutih

'सत्य, ज्ञान और अनन्त जो ब्रह्म है, उससे आकाश, वायु, अग्नि, जल, पृथ्वी, ओषधि, अन्न और देह उत्पन्न हुए' — यह श्रुति है।

'From that Brahman which is truth, knowledge and the endless arose space, air, fire, water, earth, plants, food and bodies' — so says scripture.

आपातदृष्टितस्तत्र ब्रह्मणो भाति हेतुता
हेतोश्च सत्यता तस्मादन्योन्याध्यास इष्यते ॥ १९२ ॥

āpātadṛṣṭitastatra brahmaṇo bhāti hetutā
hetośca satyatā tasmādanyonyādhyāsa iṣyate || 192 ||

Aapaatadrishtitastatra brahmano bhaati hetutaa hetoshcha satyataa tasmaadanyonyaadhyaasa ishyate

ऊपरी दृष्टि से वहाँ ब्रह्म का कारण होना भासता है और कारण की सत्यता भी; इसलिए अन्योन्याध्यास माना जाता है।

At first sight the causality of Brahman appears there, and the reality of the cause as well; therefore mutual superimposition is admitted.

अन्योन्याध्यासरूपोऽसावन्नलिप्तपटो यथा
घट्टितेनैकतामेति तद्वद्भ्रान्त्यैकतां गतः ॥ १९३ ॥

anyonyādhyāsarūpo'sāvannaliptapaṭo yathā
ghaṭṭitenaikatāmeti tadvadbhrāntyaikatāṃ gataḥ || 193 ||

Anyonyaadhyaasaruupo'saavannaliptapato yathaa ghattitenaikataameti tadvadbhraantyaikataam gatah

अन्न से लिपा हुआ पट जैसे कलफ़ किए हुए पट से एक हो जाता है, वैसे ही यह अन्योन्याध्यास-रूप भ्रान्ति से एकता को प्राप्त हुआ है।

As a cloth smeared with starch becomes one with the stiffened cloth, so this, being mutual superimposition, has come to seem one through error.

मेघाकाशमहाकाशौ विविच्येते न पामरैः
तद्वद्ब्रह्मेशयोरैक्यं पश्यन्त्यापातदर्शिनः ॥ १९४ ॥

meghākāśamahākāśau vivicyete na pāmaraiḥ
tadvadbrahmeśayoraikyaṃ paśyantyāpātadarśinaḥ || 194 ||

Meghaakaashamahaakaashau vivichyete na paamaraih tadvadbrahmeshayoraikyam pashyantyaapaatadarshinah

मेघाकाश और महाकाश को साधारण लोग अलग नहीं करते; वैसे ही ऊपरी दृष्टि वाले ब्रह्म और ईश्वर की एकता देखते हैं।

Common men do not distinguish the space in cloud from the great space; just so those who look only at the surface see Brahman and the Lord as one.

उपक्रमादिभिर्लिंगैस्तात्पर्यस्य विचारणात्
असंगं ब्रह्म मायावी सृजत्येष महेश्वरः ॥ १९५ ॥

upakramādibhirliṃgaistātparyasya vicāraṇāt
asaṃgaṃ brahma māyāvī sṛjatyeṣa maheśvaraḥ || 195 ||

Upakramaadibhirlimgaistaatparyasya vichaaranaat asamgam brahma maayaavii srijatyesha maheshvarah

उपक्रम आदि लिङ्गों से तात्पर्य का विचार करने पर — ब्रह्म असङ्ग है, और यह मायावी महेश्वर सृष्टि करता है।

When the purport is weighed by the marks of beginning and the rest — Brahman is unattached, and it is this great Lord, the wielder of illusion, who creates.

सत्यं ज्ञानमनन्तं चेत्युपक्रम्योपसंहृतम्
यतो वाचो निवर्तन्त इत्यसंगत्वनिर्णयः ॥ १९६ ॥

satyaṃ jñānamanantaṃ cetyupakramyopasaṃhṛtam
yato vāco nivartanta ityasaṃgatvanirṇayaḥ || 196 ||

Satyam jnaanamanantam chetyupakramyopasamhritam yato vaacho nivartanta ityasamgatvanirnayah

'सत्य, ज्ञान, अनन्त' से उपक्रम करके 'जहाँ से वाणी लौट आती है' से उपसंहार किया गया — यही असङ्गता का निर्णय है।

Beginning with 'truth, knowledge, the endless' it concludes with 'whence words turn back' — and that is the settling of its unattachedness.

मायी सृजति विश्वं सन्निरुद्धस्तत्र मायया
अन्य इत्यपरा ब्रूते श्रुतिस्तेनेश्वरः सृजेत् ॥ १९७ ॥

māyī sṛjati viśvaṃ sanniruddhastatra māyayā
anya ityaparā brūte śrutisteneśvaraḥ sṛjet || 197 ||

Maayii srijati vishvam sanniruddhastatra maayayaa anya ityaparaa bruute shrutisteneshvarah srijet

'मायी विश्व की सृष्टि करता है; उसमें दूसरा माया से अवरुद्ध है' — ऐसा दूसरी श्रुति कहती है; इसलिए ईश्वर ही सृष्टि करता है।

'The wielder of illusion creates the world; the other is shut in there by illusion' — so another scripture says; and therefore it is the Lord who creates.

आनन्दमय ईशोऽयं बहुस्यामित्यवैक्षत
हिरण्यगर्भरूपोऽभूत्सुप्तिः स्वप्नो यथा भवेत् ॥ १९८ ॥

ānandamaya īśo'yaṃ bahusyāmityavaikṣata
hiraṇyagarbharūpo'bhūtsuptiḥ svapno yathā bhavet || 198 ||

Aanandamaya iisho'yam bahusyaamityavaikshata hiranyagarbharuupo'bhuutsuptih svapno yathaa bhavet

आनन्दमय यह ईश्वर 'मैं बहुत हो जाऊँ' — ऐसा देखकर हिरण्यगर्भ-रूप हो गया — जैसे सुषुप्ति स्वप्न बन जाती है।

This Lord, made of bliss, looked and thought 'let me be many', and became hiraṇyagarbha — as deep sleep becomes dream.

क्रमेण युगपद्वैषा सृष्टिर्ज्ञेया यथाश्रुति
द्विविधश्रुतिसद्भावाद्विविधस्वप्नदर्शनात् ॥ १९९ ॥

krameṇa yugapadvaiṣā sṛṣṭirjñeyā yathāśruti
dvividhaśrutisadbhāvādvividhasvapnadarśanāt || 199 ||

Kramena yugapadvaishaa srishtirjneyaa yathaashruti dvividhashrutisadbhaavaadvividhasvapnadarshanaat

यह सृष्टि श्रुति के अनुसार क्रम से या एक साथ — दोनों प्रकार से जाननी चाहिए, क्योंकि दो प्रकार की श्रुतियाँ हैं और स्वप्न भी दो प्रकार के देखे जाते हैं।

This creation is to be understood, as scripture has it, either in succession or all at once, since scriptures of both kinds exist and dreams too are seen of both kinds.

सूत्रात्मा सूक्ष्मदेहाख्यः सर्वजीवघनात्मकः
सर्वाहंमानधारित्वात् क्रियाज्ञानादिशक्तिमान् ॥ २०० ॥

sūtrātmā sūkṣmadehākhyaḥ sarvajīvaghanātmakaḥ
sarvāhaṃmānadhāritvāt kriyājñānādiśaktimān || 200 ||

Suutraatmaa suukshmadehaakhyah sarvajiivaghanaatmakah sarvaahammaanadhaaritvaat kriyaajnaanaadishaktimaan

सूत्रात्मा सूक्ष्मदेह कहलाता है, सब जीवों का घन-रूप है; सब 'अहम्' के अभिमान को धारण करने से वह क्रिया और ज्ञान आदि शक्तियों वाला है।

The thread-Self is called the subtle body and is the mass of all souls; bearing every sense of 'I', it has the powers of action and knowledge and the rest.

प्रत्यूषे वा प्रदोषे वा मग्नो मन्दे तमस्ययम्
लोको भाति यथा तद्वदस्पष्टं जगदीक्ष्यते ॥ २०१ ॥

pratyūṣe vā pradoṣe vā magno mande tamasyayam
loko bhāti yathā tadvadaspaṣṭaṃ jagadīkṣyate || 201 ||

Pratyuushe vaa pradoshe vaa magno mande tamasyayam loko bhaati yathaa tadvadaspashtam jagadiikshyate

जैसे प्रातःकाल या सन्ध्या के मन्द अन्धकार में डूबा हुआ यह लोक भासता है, वैसे ही जगत् अस्पष्ट दिखाई देता है।

As this world appears when sunk in the faint darkness of dawn or dusk, so the world is then seen indistinctly.

सर्वतो लाञ्छितो मष्या यथा स्याद्घट्टितः पटः
सूक्ष्माकारैस्तथेशस्य वपुस्सर्वत्र लाञ्छितः ॥ २०२ ॥

sarvato lāñchito maṣyā yathā syādghaṭṭitaḥ paṭaḥ
sūkṣmākāraistatheśasya vapussarvatra lāñchitaḥ || 202 ||

Sarvato laanchhito mashyaa yathaa syaadghattitah patah suukshmaakaaraistatheshasya vapussarvatra laanchhitah

जैसे कलफ़ किया हुआ पट सब ओर से स्याही की रेखाओं से अङ्कित होता है, वैसे ही सूक्ष्म आकारों से ईश्वर का शरीर सब ओर अङ्कित है।

As the stiffened cloth is marked all over with ink outlines, so the Lord's body is marked all over with subtle forms.

सस्यं वा शाकजातं वा सर्वतोऽङ्कुरितं यथा
कोमलं तद्वदेवैष पेलवो जगदङ्कुरः ॥ २०३ ॥

sasyaṃ vā śākajātaṃ vā sarvato'ṅkuritaṃ yathā
komalaṃ tadvadevaiṣa pelavo jagadaṅkuraḥ || 203 ||

Sasyam vaa shaakajaatam vaa sarvato'nkuritam yathaa komalam tadvadevaisha pelavo jagadankurah

जैसे खेत की फसल या शाक सब ओर से अंकुरित होकर कोमल होता है, वैसे ही यह जगत् का अंकुर कोमल है।

As a crop or a vegetable, sprouting on every side, is tender, just so is this sprout of the world tender.

आतपाभातलोको वा पटो वा वर्णपूरितः
सस्यम् वा फलितम् यद्वत्तथा स्पष्टवपुर्विराट् ॥ २०४ ॥

ātapābhātaloko vā paṭo vā varṇapūritaḥ
sasyam vā phalitam yadvattathā spaṣṭavapurvirāṭ || 204 ||

Aatapaabhaataloko vaa pato vaa varnapuuritah sasyam vaa phalitam yadvattathaa spashtavapurviraat

जैसे धूप से भासित लोक, या रंग से भरा पट, या फल लगा हुआ खेत — वैसे ही विराट् का शरीर स्पष्ट है।

As the world lit by sunlight, or a cloth filled with colour, or a crop in fruit — so is the cosmic person's body plain to see.

विश्वरूपाध्याय एष उक्तिः सूक्तेऽपि पौरुषे
धात्रादिस्तंबपर्यन्तानेतस्यावयवान् विदुः ॥ २०५ ॥

viśvarūpādhyāya eṣa uktiḥ sūkte'pi pauruṣe
dhātrādistaṃbaparyantānetasyāvayavān viduḥ || 205 ||

Vishvaruupaadhyaaya esha uktih suukte'pi paurushe dhaatraadistambaparyantaanetasyaavayavaan viduh

विश्वरूप-अध्याय में और पुरुषसूक्त में भी यही कहा गया है; ब्रह्मा से लेकर तृण तक को इसके अवयव जानते हैं।

This is said in the chapter on the cosmic form and in the hymn to the Person as well; from the creator down to a tuft of grass all are known as his limbs.

ईशसूत्रविराड्वेधोविष्णुरुद्रेन्द्रवह्नयः
विघ्नभैरवमैरालमरिकायक्षराक्षसाः ॥ २०६ ॥

īśasūtravirāḍvedhoviṣṇurudrendravahnayaḥ
vighnabhairavamairālamarikāyakṣarākṣasāḥ || 206 ||

Iishasuutraviraadvedhovishnurudrendravahnayah vighnabhairavamairaalamarikaayaksharaakshasaah

ईश, सूत्र, विराट्, ब्रह्मा, विष्णु, रुद्र, इन्द्र, अग्नि, विघ्नेश, भैरव, मैराल, मारी, यक्ष और राक्षस —

The Lord, the thread-Self, the cosmic person, the creator, Viṣṇu, Rudra, Indra, Fire, the lord of obstacles, Bhairava, Mairāla, the goddess of pestilence, the yakṣas and the rākṣasas —

विप्रक्षत्रियविट्छूद्रा गवाश्वमृगपक्षिणः
अश्वत्थवटचूताद्या यवव्रीहितृणादयः ॥ २०७ ॥

viprakṣatriyaviṭchūdrā gavāśvamṛgapakṣiṇaḥ
aśvatthavaṭacūtādyā yavavrīhitṛṇādayaḥ || 207 ||

Viprakshatriyavitchhuudraa gavaashvamrigapakshinah ashvatthavatachuutaadyaa yavavriihitrinaadayah

ब्राह्मण, क्षत्रिय, वैश्य, शूद्र; गाय, घोड़ा, मृग, पक्षी; पीपल, वट, आम आदि; जौ, धान, तृण आदि —

Brāhmaṇa, Kṣatriya, Vaiśya and Śūdra; cow, horse, deer and bird; fig, banyan, mango and the rest; barley, rice, grass and the rest —

जलपाषाणमृत्काष्ठवास्याकुद्दालकादयः
ईश्वरास्सर्व एवैते पूजिताः फलदायिनः ॥ २०८ ॥

jalapāṣāṇamṛtkāṣṭhavāsyākuddālakādayaḥ
īśvarāssarva evaite pūjitāḥ phaladāyinaḥ || 208 ||

Jalapaashaanamritkaashthavaasyaakuddaalakaadayah iishvaraassarva evaite puujitaah phaladaayinah

जल, पत्थर, मिट्टी, काठ, बसूला, कुदाल आदि — ये सब ईश्वर ही हैं; पूजे जाने पर फल देते हैं।

water, stone, clay, wood, adze, hoe and the rest — all these are the Lord, and when worshipped they give their fruit.

यथा यथोपासते तम् फलमीयुस्तथा तथा
फलोत्कर्षापकर्षौ तु पूज्यपूजानुसारतः ॥ २०९ ॥

yathā yathopāsate tam phalamīyustathā tathā
phalotkarṣāpakarṣau tu pūjyapūjānusārataḥ || 209 ||

Yathaa yathopaasate tam phalamiiyustathaa tathaa phalotkarshaapakarshau tu puujyapuujaanusaaratah

जो जिस प्रकार उसकी उपासना करता है, उसी प्रकार फल पाता है; फल का उत्कर्ष और अपकर्ष पूज्य और पूजा के अनुसार होता है।

As each worships him, so does each get his fruit; and the fruit is greater or less according to the object worshipped and the worship offered.

मुक्तिस्तु ब्रह्मतत्त्वस्य ज्ञानादेव न चान्यथा
स्वप्रबोधं विना नैव स्वस्वप्नो हीयते यथा ॥ २१० ॥

muktistu brahmatattvasya jñānādeva na cānyathā
svaprabodhaṃ vinā naiva svasvapno hīyate yathā || 210 ||

Muktistu brahmatattvasya jnaanaadeva na chaanyathaa svaprabodham vinaa naiva svasvapno hiiyate yathaa

किन्तु मुक्ति ब्रह्म-तत्त्व के ज्ञान से ही होती है, और किसी प्रकार नहीं; जैसे अपने जागने के बिना अपना स्वप्न नहीं छूटता।

But release comes only from the knowledge of the reality of Brahman and in no other way — as one's own dream does not go without one's own waking.

अद्वितीयब्रह्मतत्वे स्वप्नोऽयमखिलं जगत्
ईशजीवादिरूपेण चेतनाचेतनात्मकम् ॥ २११ ॥

advitīyabrahmatatve svapno'yamakhilaṃ jagat
īśajīvādirūpeṇa cetanācetanātmakam || 211 ||

Advitiiyabrahmatatve svapno'yamakhilam jagat iishajiivaadiruupena chetanaachetanaatmakam

अद्वितीय ब्रह्म-तत्त्व में यह सारा जगत् स्वप्न है — ईश्वर, जीव आदि के रूप में, चेतन और अचेतन से भरा हुआ।

In the non-dual reality of Brahman this whole world is a dream — in the form of Lord and soul and the rest, made of sentient and insentient.

आनन्दमयविज्ञानमयावीश्वरजीवकौ
मायया कल्पितावेतौ ताभ्यां सर्वम् प्रकल्पितम् ॥ २१२ ॥

ānandamayavijñānamayāvīśvarajīvakau
māyayā kalpitāvetau tābhyāṃ sarvam prakalpitam || 212 ||

Aanandamayavijnaanamayaaviishvarajiivakau maayayaa kalpitaavetau taabhyaam sarvam prakalpitam

आनन्दमय और विज्ञानमय — ये ईश्वर और जीव माया से कल्पित हैं; और उन दोनों से सब कुछ कल्पित हुआ है।

The sheaths of bliss and of understanding, that is, the Lord and the soul, are imagined by illusion; and by those two all else is imagined.

ईक्षणादिप्रवेशान्ता सृष्टिरीशेन कल्पिता
जाग्रदादिविमोक्षान्तस्संसारो जीवकल्पितः ॥ २१३ ॥

īkṣaṇādipraveśāntā sṛṣṭirīśena kalpitā
jāgradādivimokṣāntassaṃsāro jīvakalpitaḥ || 213 ||

Iikshanaadipraveshaantaa srishtiriishena kalpitaa jaagradaadivimokshaantassamsaaro jiivakalpitah

ईक्षण से लेकर प्रवेश तक की सृष्टि ईश्वर ने कल्पित की है; और जाग्रत् से लेकर मोक्ष तक का संसार जीव ने।

The creation from the first looking to the entering is imagined by the Lord; and the round of birth and death from waking to release is imagined by the soul.

अद्वितीयं ब्रह्मतत्त्वमसंगं तन्न जायते
जीवेशयोर्मायिकयोर्वृथैव कलहं ययुः ॥ २१४ ॥

advitīyaṃ brahmatattvamasaṃgaṃ tanna jāyate
jīveśayormāyikayorvṛthaiva kalahaṃ yayuḥ || 214 ||

Advitiiyam brahmatattvamasamgam tanna jaayate jiiveshayormaayikayorvrithaiva kalaham yayuh

अद्वितीय ब्रह्म-तत्त्व असङ्ग है, वह उत्पन्न नहीं होता; मायिक जीव और ईश्वर के विषय में लोग व्यर्थ ही झगड़ते रहे।

The non-dual reality of Brahman is unattached and is not born; men have quarrelled in vain about the soul and the Lord, which belong to illusion.

ज्ञात्वा सदा तत्त्वनिष्ठां ननु मोदामहे वयम्
अनुशोचाम एवान्यान्न भ्रान्तैर्विवदामहे ॥ २१५ ॥

jñātvā sadā tattvaniṣṭhāṃ nanu modāmahe vayam
anuśocāma evānyānna bhrāntairvivadāmahe || 215 ||

Jnaatvaa sadaa tattvanishthaam nanu modaamahe vayam anushochaama evaanyaanna bhraantairvivadaamahe

यह जानकर तत्त्व में सदा निष्ठा रखते हुए हम आनन्दित होते हैं; दूसरों के लिए शोक ही करते हैं, भ्रान्तों से विवाद नहीं करते।

Knowing this and abiding always in the truth we rejoice; for others we only grieve, and we do not dispute with the deluded.

तृणार्चकादियोगान्ता ईश्वरे भ्रान्तिमाश्रिताः
लोकायतादिसांख्यान्ता जीवे विश्रान्तिमाश्रिताः ॥ २१६ ॥

tṛṇārcakādiyogāntā īśvare bhrāntimāśritāḥ
lokāyatādisāṃkhyāntā jīve viśrāntimāśritāḥ || 216 ||

Trinaarchakaadiyogaantaa iishvare bhraantimaashritaah lokaayataadisaamkhyaantaa jiive vishraantimaashritaah

तृण की अर्चा करने वालों से लेकर योगियों तक सब ईश्वर में भ्रान्ति का आश्रय लिए हैं; और लोकायत से लेकर साङ्ख्य तक सब जीव में ही विश्रान्ति लिए हैं।

From those who worship a tuft of grass up to the yogins, all rest on an error about the Lord; and from the materialists up to the Sāṅkhyas, all come to rest in the soul.

अद्वितीयब्रह्मतत्त्वं न जानन्ति यदा तदा
भ्रान्ता एवाखिलास्तेषां क्व मुक्तिः क्वेह वा सुखम् ॥ २१७ ॥

advitīyabrahmatattvaṃ na jānanti yadā tadā
bhrāntā evākhilāsteṣāṃ kva muktiḥ kveha vā sukham || 217 ||

Advitiiyabrahmatattvam na jaananti yadaa tadaa bhraantaa evaakhilaasteshaam kva muktih kveha vaa sukham

जब तक वे अद्वितीय ब्रह्म-तत्त्व को नहीं जानते, तब तक सब भ्रान्त ही हैं; उनके लिए मुक्ति कहाँ, और यहाँ सुख कहाँ?

So long as they do not know the non-dual reality of Brahman they are all deluded; where then is release for them, and where happiness here?

उत्तमाधमभावश्चेत्तेषां स्यादस्तु तेन किम्
स्वप्नस्थराज्यभिक्षाभ्यां न बुद्धः स्पृश्यते खलु ॥ २१८ ॥

uttamādhamabhāvaścetteṣāṃ syādastu tena kim
svapnastharājyabhikṣābhyāṃ na buddhaḥ spṛśyate khalu || 218 ||

Uttamaadhamabhaavashchetteshaam syaadastu tena kim svapnastharaajyabhikshaabhyaam na buddhah sprishyate khalu

यदि उनमें उत्तम और अधम का भेद हो, तो हो — उससे क्या? स्वप्न के राज्य और भिक्षा से जागा हुआ व्यक्ति तो छुआ नहीं जाता।

If among them there be higher and lower, let it be — what of it? The man awake is not touched by a kingdom or a beggary seen in dream.

तस्मान्मुमुक्षुभिर्नैव मतिर्जीवेशवादयोः
कार्या किंतु ब्रह्मतत्वं विचार्यं बुद्यतां च तत् ॥ २१९ ॥

tasmānmumukṣubhirnaiva matirjīveśavādayoḥ
kāryā kiṃtu brahmatatvaṃ vicāryaṃ budyatāṃ ca tat || 219 ||

Tasmaanmumukshubhirnaiva matirjiiveshavaadayoh kaaryaa kimtu brahmatatvam vichaaryam budyataam cha tat

इसलिए मुमुक्षुओं को जीववाद और ईश्वरवाद में मन नहीं लगाना चाहिए; बल्कि ब्रह्म-तत्त्व का विचार करना चाहिए और उसे जानना चाहिए।

Therefore those who seek release should not set their minds on the doctrines of soul and of Lord, but should enquire into the reality of Brahman and know it.

पूर्वपक्षतया तौ चेत्तत्त्वनिश्चयहेतुताम्
प्राप्नुतोऽस्तु निमज्जस्व तयोर्नैतावताऽवशः ॥ २२० ॥

pūrvapakṣatayā tau cettattvaniścayahetutām
prāpnuto'stu nimajjasva tayornaitāvatā'vaśaḥ || 220 ||

Puurvapakshatayaa tau chettattvanishchayahetutaam praapnuto'stu nimajjasva tayornaitaavataa'vashah

यदि वे पूर्वपक्ष के रूप में तत्त्व-निश्चय के हेतु बन जाएँ तो बन जाएँ; उनमें डूबो भी, पर इतने से उनके वश में न हो जाओ।

If as opposing views they serve to settle the truth, let them; immerse yourself in them too — but not so far as to fall into their power.

असंगचिद्विभुर्जीवस्सांख्योक्तस्तादृगीश्वरः
योगोक्तस्तत्त्वमोरर्थौ शुद्धौ ताविति चेच्छृणु ॥ २२१ ॥

asaṃgacidvibhurjīvassāṃkhyoktastādṛgīśvaraḥ
yogoktastattvamorarthau śuddhau tāviti cecchṛṇu || 221 ||

Asamgachidvibhurjiivassaamkhyoktastaadrigiishvarah yogoktastattvamorarthau shuddhau taaviti chechchhrinu

यदि कहो कि साङ्ख्य का कहा असङ्ग, चित्, विभु जीव और योग का कहा वैसा ही ईश्वर — ये 'तत्' और 'त्वम्' के शुद्ध अर्थ हैं — तो सुनो।

If you say that the unattached, conscious, all-pervading soul of the Sāṅkhyas and the like Lord of the Yoga are the pure meanings of 'That' and 'thou', then listen.

न तत्त्वमोरुभावार्थावस्मत्सिद्धान्ततां गतौ
अद्वैतबोधनायैव सा कक्षा काचिदिष्यते ॥ २२२ ॥

na tattvamorubhāvārthāvasmatsiddhāntatāṃ gatau
advaitabodhanāyaiva sā kakṣā kācidiṣyate || 222 ||

Na tattvamorubhaavaarthaavasmatsiddhaantataam gatau advaitabodhanaayaiva saa kakshaa kaachidishyate

'तत्' और 'त्वम्' के वे अर्थ हमारे सिद्धान्त तक नहीं पहुँचे; अद्वैत के बोध के लिए ही वह कोई एक कक्षा मानी जाती है।

Those meanings of 'That' and 'thou' have not reached our conclusion; that stage is admitted only as a step towards the knowledge of non-duality.

अनादिमायया भ्रान्ता जीवेशौ सुविलक्षणौ
मन्यन्ते तद्व्युदासाय केवलं शोधनं तयोः ॥ २२३ ॥

anādimāyayā bhrāntā jīveśau suvilakṣaṇau
manyante tadvyudāsāya kevalaṃ śodhanaṃ tayoḥ || 223 ||

Anaadimaayayaa bhraantaa jiiveshau suvilakshanau manyante tadvyudaasaaya kevalam shodhanam tayoh

अनादि माया से भ्रान्त लोग जीव और ईश्वर को अत्यन्त विलक्षण मानते हैं; उसी को हटाने के लिए उन दोनों का केवल शोधन किया जाता है।

Men deluded by beginningless illusion hold soul and Lord to be utterly unlike; only to set that aside are the two purified.

अत एवात्र दृष्टान्तो योग्यः प्राक् सम्यगीरितः
घटाकाशमहाकाशजलाकाशाभ्रखात्मकः ॥ २२४ ॥

ata evātra dṛṣṭānto yogyaḥ prāk samyagīritaḥ
ghaṭākāśamahākāśajalākāśābhrakhātmakaḥ || 224 ||

Ata evaatra drishtaanto yogyah praak samyagiiritah ghataakaashamahaakaashajalaakaashaabhrakhaatmakah

इसीलिए यहाँ पहले भलीभाँति कहा गया दृष्टान्त उपयुक्त है — घटाकाश, महाकाश, जलाकाश और मेघाकाश वाला।

That is why the example given fully before is fitting here — of the space in the pot, the great space, the space in water and the space in cloud.

जलाभ्रोपाध्यधीने ते जलाकाशाभ्रखे तयोः
आधारौ तु घटाकाशमहाकाशौ सुनिर्मलौ ॥ २२५ ॥

jalābhropādhyadhīne te jalākāśābhrakhe tayoḥ
ādhārau tu ghaṭākāśamahākāśau sunirmalau || 225 ||

Jalaabhropaadhyadhiine te jalaakaashaabhrakhe tayoh aadhaarau tu ghataakaashamahaakaashau sunirmalau

जलाकाश और मेघाकाश जल तथा मेघ रूपी उपाधियों के अधीन हैं; और उन दोनों के आधार घटाकाश और महाकाश अत्यन्त निर्मल हैं।

The space in water and the space in cloud depend on the adjuncts of water and cloud; while their grounds, the space in the pot and the great space, are quite clear.

एवमानन्दविज्ञानमयौ मायाधियोर्वशौ
तदधिष्ठानकूटस्थब्रह्मणी तु सुनिर्मले ॥ २२६ ॥

evamānandavijñānamayau māyādhiyorvaśau
tadadhiṣṭhānakūṭasthabrahmaṇī tu sunirmale || 226 ||

Evamaanandavijnaanamayau maayaadhiyorvashau tadadhishthaanakuutasthabrahmanii tu sunirmale

इसी प्रकार आनन्दमय और विज्ञानमय माया और बुद्धि के वश में हैं; और उनके अधिष्ठान कूटस्थ और ब्रह्म अत्यन्त निर्मल हैं।

Just so the sheaths of bliss and of understanding are in the power of illusion and of the understanding; and their grounds, the unchanging one and Brahman, are quite clear.

एतत्कक्षोपयोगेन साङ्ख्ययोगौ मतौ यदि
देहोऽन्नमयकक्षत्वादात्मत्वेनाभ्युपेयताम् ॥ २२७ ॥

etatkakṣopayogena sāṅkhyayogau matau yadi
deho'nnamayakakṣatvādātmatvenābhyupeyatām || 227 ||

Etatkakshopayogena saankhyayogau matau yadi deho'nnamayakakshatvaadaatmatvenaabhyupeyataam

यदि इस कक्षा के उपयोग से साङ्ख्य और योग मान्य हों, तो अन्नमय कोश की कक्षा होने से देह को भी आत्मा मान लेना चाहिए।

If the Sāṅkhya and the Yoga are to be accepted for the use of this stage, then the body too, being the stage of the sheath of food, should be accepted as the Self.

आत्मभेदो जगत्सत्यमीशोऽन्य इति चेत्त्रयम्
त्यज्यते तैस्तदा साङ्ख्ययोगवेदान्तसम्मतिः ॥ २२८ ॥

ātmabhedo jagatsatyamīśo'nya iti cettrayam
tyajyate taistadā sāṅkhyayogavedāntasammatiḥ || 228 ||

Aatmabhedo jagatsatyamiisho'nya iti chettrayam tyajyate taistadaa saankhyayogavedaantasammatih

यदि वे तीनों — आत्माओं का भेद, जगत् की सत्यता, और ईश्वर का भिन्न होना — छोड़ दें, तब साङ्ख्य, योग और वेदान्त का मेल हो जाएगा।

If they give up the three — a plurality of selves, the reality of the world, and a Lord apart — then Sāṅkhya, Yoga and Vedānta will agree.

जीवोऽसंगत्वमात्रेण कृतार्थ इति चेत्तदा
स्रक्चंदनादिनित्यत्वमात्रेणापि कृतार्थता ॥ २२९ ॥

jīvo'saṃgatvamātreṇa kṛtārtha iti cettadā
srakcaṃdanādinityatvamātreṇāpi kṛtārthatā || 229 ||

Jiivo'samgatvamaatrena kritaartha iti chettadaa srakchamdanaadinityatvamaatrenaapi kritaarthataa

यदि कहो कि जीव केवल असङ्ग होने से ही कृतार्थ है, तो माला और चन्दन आदि के केवल नित्य होने से भी कृतार्थता हो जाएगी।

If you say the soul is fulfilled merely by being unattached, then it would be fulfilled merely by the eternity of a garland or sandal paste.

यथा स्रगादिनित्यत्वं दुःसंपादं तथाऽत्मनः
असंगत्वं न संभाव्यं जीवतोर्जगदीशयोः ॥ २३० ॥

yathā sragādinityatvaṃ duḥsaṃpādaṃ tathā'tmanaḥ
asaṃgatvaṃ na saṃbhāvyaṃ jīvatorjagadīśayoḥ || 230 ||

Yathaa sragaadinityatvam duhsampaadam tathaa'tmanah asamgatvam na sambhaavyam jiivatorjagadiishayoh

जैसे माला आदि का नित्य होना कठिन है, वैसे ही जगत् और ईश्वर के रहते जीव की असङ्गता सम्भव नहीं।

As the eternity of a garland and the like is hard to secure, so the unattachedness of the soul is not possible while world and Lord remain.

अवश्यं प्रकृतिस्सङ्गं पुरेवापादयेत्तदा
नियच्छत्येतमीशोऽपि कोऽस्य मोक्षस्तथा सति ॥ २३१ ॥

avaśyaṃ prakṛtissaṅgaṃ purevāpādayettadā
niyacchatyetamīśo'pi ko'sya mokṣastathā sati || 231 ||

Avashyam prakritissangam purevaapaadayettadaa niyachchhatyetamiisho'pi ko'sya mokshastathaa sati

प्रकृति उस समय पहले की तरह अवश्य ही आसक्ति उत्पन्न कर देगी; और ईश्वर भी इसका नियमन करता है — तो ऐसे में इसका मोक्ष क्या?

Nature will then surely bring about attachment as before; and the Lord too governs it — what release can it have in such a case?

अविवेककृतसंगो नियमश्चेति चेत्तदा
बलादापतितो मायावादस्सांख्यस्य दुर्मतेः ॥ २३२ ॥

avivekakṛtasaṃgo niyamaśceti cettadā
balādāpatito māyāvādassāṃkhyasya durmateḥ || 232 ||

Avivekakritasamgo niyamashcheti chettadaa balaadaapatito maayaavaadassaamkhyasya durmateh

यदि कहो कि आसक्ति और नियमन अविवेक से किए गए हैं, तो दुर्मति साङ्ख्य पर बलपूर्वक मायावाद ही आ पड़ा।

If you say that the attachment and the governing are made by want of discernment, then the doctrine of illusion has come upon the ill-minded Sāṅkhya by force.

बन्धमोक्षव्यवस्थार्थमात्मनानात्वमिष्यताम्
इति चेन्न यतो माया व्यवस्थापयितुं क्षमा ॥ २३३ ॥

bandhamokṣavyavasthārthamātmanānātvamiṣyatām
iti cenna yato māyā vyavasthāpayituṃ kṣamā || 233 ||

Bandhamokshavyavasthaarthamaatmanaanaatvamishyataam iti chenna yato maayaa vyavasthaapayitum kshamaa

यदि कहो कि बन्ध और मोक्ष की व्यवस्था के लिए आत्माओं की अनेकता माननी चाहिए — तो नहीं, क्योंकि माया ही व्यवस्था करने में समर्थ है।

If you say that a plurality of selves must be admitted to keep bondage and release in order — no, for illusion is able to keep that order.

दुर्घटं घटयामीति विरुद्धं किं न पश्यसि
वास्तवौ बंधमोक्षौ तु श्रुतिर्न सहतेतराम् ॥ २३४ ॥

durghaṭaṃ ghaṭayāmīti viruddhaṃ kiṃ na paśyasi
vāstavau baṃdhamokṣau tu śrutirna sahatetarām || 234 ||

Durghatam ghatayaamiiti viruddham kim na pashyasi vaastavau bamdhamokshau tu shrutirna sahatetaraam

'मैं असम्भव को सम्भव करती हूँ' — इस विरोध को क्या तुम नहीं देखते? और वास्तविक बन्ध तथा मोक्ष को तो श्रुति किसी प्रकार सहन नहीं करती।

'I make the impossible happen' — do you not see this contradiction? And a real bondage and release scripture will not bear at all.

न निरोधो न चोत्पत्तिर्न बद्धो न च साधकः
न मुमुक्षुर्न वै मुक्त इत्येषा परमार्थता ॥ २३५ ॥

na nirodho na cotpattirna baddho na ca sādhakaḥ
na mumukṣurna vai mukta ityeṣā paramārthatā || 235 ||

Na nirodho na chotpattirna baddho na cha saadhakah na mumukshurna vai mukta ityeshaa paramaarthataa

'न निरोध है, न उत्पत्ति; न कोई बद्ध है, न साधक; न कोई मुमुक्षु है, न मुक्त' — यही परमार्थ है।

'There is no restraining and no arising; none bound and none striving; none seeking release and none released' — this is the highest truth.

मायाख्यायाः कामधेनोर्वत्सौ जीवेश्वरावुभौ
यथेच्छं पिबतां द्वैतं तत्त्वं त्वद्वैतमेव हि ॥ २३६ ॥

māyākhyāyāḥ kāmadhenorvatsau jīveśvarāvubhau
yathecchaṃ pibatāṃ dvaitaṃ tattvaṃ tvadvaitameva hi || 236 ||

Maayaakhyaayaah kaamadhenorvatsau jiiveshvaraavubhau yathechchham pibataam dvaitam tattvam tvadvaitameva hi

माया नाम की कामधेनु के जीव और ईश्वर — ये दो बछड़े हैं; वे इच्छानुसार द्वैत को पिएँ, पर तत्त्व तो अद्वैत ही है।

The soul and the Lord are the two calves of the wish-cow named illusion; let them drink duality as they please — the truth is non-duality alone.

कूटस्थब्रह्मणोर्भेदो नाममात्रादृते न हि
घटाकाशमहाकाशौ वियुज्येते न हि क्वचित् ॥ २३७ ॥

kūṭasthabrahmaṇorbhedo nāmamātrādṛte na hi
ghaṭākāśamahākāśau viyujyete na hi kvacit || 237 ||

Kuutasthabrahmanorbhedo naamamaatraadrite na hi ghataakaashamahaakaashau viyujyete na hi kvachit

कूटस्थ और ब्रह्म का भेद नाममात्र के सिवा है ही नहीं; घटाकाश और महाकाश कहीं भी अलग नहीं होते।

Between the unchanging one and Brahman there is no difference but in name; the space in the pot and the great space are nowhere separated.

यदद्वैतं श्रुतं सृष्टेः प्राक् तदेवाद्य चोपरि
मुक्तावपि वृथा माया भ्रामयत्यखिलान् जनान् ॥ २३८ ॥

yadadvaitaṃ śrutaṃ sṛṣṭeḥ prāk tadevādya copari
muktāvapi vṛthā māyā bhrāmayatyakhilān janān || 238 ||

Yadadvaitam shrutam srishteh praak tadevaadya chopari muktaavapi vrithaa maayaa bhraamayatyakhilaan janaan

जो अद्वैत सृष्टि से पहले सुना गया, वही आज है और आगे मुक्ति में भी रहेगा; माया व्यर्थ ही सब लोगों को भ्रमाती है।

The non-duality heard of before creation is the same today and afterwards, in release as well; illusion bewilders all men to no purpose.

ये वदन्तीत्थमेतेऽपि भ्राम्यन्तेऽविद्ययात्र किम्
न यथापूर्वमेतेषामत्र भ्रान्तेरदर्शनात् ॥ २३९ ॥

ye vadantītthamete'pi bhrāmyante'vidyayātra kim
na yathāpūrvameteṣāmatra bhrānteradarśanāt || 239 ||

Ye vadantiitthamete'pi bhraamyante'vidyayaatra kim na yathaapuurvameteshaamatra bhraanteradarshanaat

शङ्का: जो ऐसा कहते हैं, क्या वे भी यहाँ अविद्या से भ्रमाए जाते हैं? — नहीं, क्योंकि उनमें पहले जैसी भ्रान्ति अब नहीं देखी जाती।

An objection: are those who speak so also bewildered here by nescience? No, for in them the earlier delusion is no longer seen.

ऐहिकामुष्मिकः सर्वः संसारो वास्तवस्ततः
न भाति नास्ति चाद्वैतमित्यज्ञानिविनिश्चयः ॥ २४० ॥

aihikāmuṣmikaḥ sarvaḥ saṃsāro vāstavastataḥ
na bhāti nāsti cādvaitamityajñāniviniścayaḥ || 240 ||

Aihikaamushmikah sarvah samsaaro vaastavastatah na bhaati naasti chaadvaitamityajnaanivinishchayah

'इस लोक और परलोक का सारा संसार वास्तविक है; अद्वैत न भासता है न है' — यह अज्ञानी का निश्चय है।

'The whole round of this world and the next is real; non-duality neither shines nor is' — such is the ignorant man's conviction.

ज्ञानिनो विपरीतोऽस्मान्निश्चयः सम्यगीक्ष्यते
स्वस्य निश्चयतो बद्धो मुक्तोऽहं चेति मन्यते ॥ २४१ ॥

jñānino viparīto'smānniścayaḥ samyagīkṣyate
svasya niścayato baddho mukto'haṃ ceti manyate || 241 ||

Jnaanino vipariito'smaannishchayah samyagiikshyate svasya nishchayato baddho mukto'ham cheti manyate

ज्ञानी का निश्चय इससे उल्टा भलीभाँति देखा जाता है; अपने निश्चय से ही वह मानता है कि 'मैं बद्ध हूँ' या 'मैं मुक्त हूँ'।

The knower's conviction is seen to be just the opposite of this; it is by his own conviction that a man thinks 'I am bound' or 'I am free'.

नाद्वैतमपरोक्षम् चेन्न चिद्रूपेण भासनात्
अशेषेण न भातं चेत् द्वैतम् किं भासते तव ॥ २४२ ॥

nādvaitamaparokṣam cenna cidrūpeṇa bhāsanāt
aśeṣeṇa na bhātaṃ cet dvaitam kiṃ bhāsate tava || 242 ||

Naadvaitamaparoksham chenna chidruupena bhaasanaat asheshena na bhaatam chet dvaitam kim bhaasate tava

यदि कहो 'अद्वैत अपरोक्ष नहीं है' — तो ऐसा नहीं, क्योंकि वह चिद्रूप से भासता है। यदि कहो 'पूरी तरह नहीं भासा' — तो बताओ, तुम्हें द्वैत ही कितना भासता है?

If you say non-duality is not directly present — not so, for it shines as awareness itself. If you say it does not shine entirely, then tell us how far duality shines for you.

दिङ्मात्रेण विभानं तु द्वयोरपि समं खलु
द्वैतसिद्धिवदद्वैतसिद्धिस्ते तावता न किम् ॥ २४३ ॥

diṅmātreṇa vibhānaṃ tu dvayorapi samaṃ khalu
dvaitasiddhivadadvaitasiddhiste tāvatā na kim || 243 ||

Dinmaatrena vibhaanam tu dvayorapi samam khalu dvaitasiddhivadadvaitasiddhiste taavataa na kim

दिशामात्र से भासना तो दोनों में समान ही है; तो द्वैत की सिद्धि की तरह उतने से अद्वैत की सिद्धि क्यों नहीं?

Shining in a general way is equal in both; then why is non-duality not established by so much, as duality is?

द्वैतेन हीनमद्वैतं द्वैतज्ञाने कथं त्विदम्
चिद्भानं त्वविरोध्यस्य द्वैतस्यातोऽसमे उभे ॥ २४४ ॥

dvaitena hīnamadvaitaṃ dvaitajñāne kathaṃ tvidam
cidbhānaṃ tvavirodhyasya dvaitasyāto'same ubhe || 244 ||

Dvaitena hiinamadvaitam dvaitajnaane katham tvidam chidbhaanam tvavirodhyasya dvaitasyaato'same ubhe

शङ्का: अद्वैत द्वैत से रहित है; द्वैत के ज्ञान में यह कैसे बने? — उत्तर: चित् का भासना द्वैत का विरोधी नहीं; इसलिए दोनों समान नहीं हैं।

An objection: non-duality is without duality, so how can it be while duality is known? The answer: the shining of awareness is not opposed to duality, so the two are not on a par.

एवं तर्हि शृणु द्वैतमसन्मायामयत्वतः
तेन वास्तवमद्वैतं परिशेषाद्विभासते ॥ २४५ ॥

evaṃ tarhi śṛṇu dvaitamasanmāyāmayatvataḥ
tena vāstavamadvaitaṃ pariśeṣādvibhāsate || 245 ||

Evam tarhi shrinu dvaitamasanmaayaamayatvatah tena vaastavamadvaitam parisheshaadvibhaasate

तो फिर सुनो — द्वैत असत् और मायामय है; इसलिए परिशेष से वास्तविक अद्वैत ही भासित होता है।

Then listen: duality is unreal, made of illusion; and therefore, by what is left over, the real non-duality shines forth.

अचिन्त्यरचनारूपं मायैव सकलं जगत्
इति निश्चित्य वस्तुत्वमद्वैते परिशेष्यताम् ॥ २४६ ॥

acintyaracanārūpaṃ māyaiva sakalaṃ jagat
iti niścitya vastutvamadvaite pariśeṣyatām || 246 ||

Achintyarachanaaruupam maayaiva sakalam jagat iti nishchitya vastutvamadvaite parisheshyataam

यह सारा जगत् अचिन्त्य रचना-रूप माया ही है — ऐसा निश्चय करके वस्तुत्व को अद्वैत में ही शेष रखना चाहिए।

Settling it that this whole world is illusion, being an unthinkable making, let reality be left over in non-duality alone.

पुनर्द्वैतस्य वस्तुत्वं भाति चेत्त्वं तथा पुनः
परिशीलय को वात्र प्रयासस्तेन ते वद ॥ २४७ ॥

punardvaitasya vastutvaṃ bhāti cettvaṃ tathā punaḥ
pariśīlaya ko vātra prayāsastena te vada || 247 ||

Punardvaitasya vastutvam bhaati chettvam tathaa punah parishiilaya ko vaatra prayaasastena te vada

यदि फिर द्वैत का वस्तुत्व भासने लगे, तो तुम फिर वैसे ही अभ्यास करो; इसमें क्या परिश्रम है — बताओ?

If the reality of duality shines again, then practise again in the same way; what labour is there in that — tell us?

कियन्तं कालमिति चेत् खेदोऽयं द्वैत इष्यताम्
अद्वैते तु न युक्तोऽयं सर्वानर्थनिवारणात् ॥ २४८ ॥

kiyantaṃ kālamiti cet khedo'yaṃ dvaita iṣyatām
advaite tu na yukto'yaṃ sarvānarthanivāraṇāt || 248 ||

Kiyantam kaalamiti chet khedo'yam dvaita ishyataam advaite tu na yukto'yam sarvaanarthanivaaranaat

यदि पूछो 'कब तक?' — तो यह खेद द्वैत में हो; अद्वैत में यह उचित नहीं, क्योंकि वह सब अनर्थों का निवारण करता है।

If you ask 'for how long?', let that weariness belong to duality; in non-duality it is out of place, since it wards off every ill.

क्षुत्पिपासादयो दृष्टा यथापूर्वं मयीति चेत्
मच्छब्दवाच्येऽहंकारे दृश्यन्तां नेति को वदेत् ॥ २४९ ॥

kṣutpipāsādayo dṛṣṭā yathāpūrvaṃ mayīti cet
macchabdavācye'haṃkāre dṛśyantāṃ neti ko vadet || 249 ||

Kshutpipaasaadayo drishtaa yathaapuurvam mayiiti chet machchhabdavaachye'hamkaare drishyantaam neti ko vadet

यदि कहो 'भूख, प्यास आदि तो मुझमें पहले की तरह ही दिखाई देते हैं' — तो 'मैं' शब्द से कहे जाने वाले अहंकार में वे दिखें; कौन 'नहीं' कहता है?

If you say 'hunger, thirst and the rest are seen in me as before', then let them be seen in the I-sense, which the word 'me' denotes; who says they are not?

चिद्रूपेऽपि प्रसज्येरंस्तादात्म्याध्यासतो यदि
माध्यासं कुरु किंतु त्वं विवेकं कुरु सर्वदा ॥ २५० ॥

cidrūpe'pi prasajyeraṃstādātmyādhyāsato yadi
mādhyāsaṃ kuru kiṃtu tvaṃ vivekaṃ kuru sarvadā || 250 ||

Chidruupe'pi prasajyeramstaadaatmyaadhyaasato yadi maadhyaasam kuru kimtu tvam vivekam kuru sarvadaa

यदि तादात्म्य-अध्यास से वे चिद्रूप में भी आ पड़ें — तो अध्यास मत करो, बल्कि सदा विवेक करो।

If through the superimposition of identity they seem to belong to awareness as well — then do not superimpose, but practise discernment always.

झटित्यध्यास आयाति दृढवासनयेति चेत्
आवर्तयेद्विवेकं च दृढं वासयितुं सदा ॥ २५१ ॥

jhaṭityadhyāsa āyāti dṛḍhavāsanayeti cet
āvartayedvivekaṃ ca dṛḍhaṃ vāsayituṃ sadā || 251 ||

Jhatityadhyaasa aayaati dridhavaasanayeti chet aavartayedvivekam cha dridham vaasayitum sadaa

यदि कहो कि दृढ़ वासना से अध्यास तुरन्त आ जाता है — तो दृढ़ वासना बनाने के लिए विवेक को भी सदा दोहराओ।

If you say that by a strong habit the superimposition returns at once — then repeat the discernment too, always, to make the habit strong.

विवेके द्वैतमिथ्यात्वं युक्तैवेति न भण्यताम्
अचिन्त्यरचनात्वस्यानुभूतिर्हि स्वसाक्षिकी ॥ २५२ ॥

viveke dvaitamithyātvaṃ yuktaiveti na bhaṇyatām
acintyaracanātvasyānubhūtirhi svasākṣikī || 252 ||

Viveke dvaitamithyaatvam yuktaiveti na bhanyataam achintyarachanaatvasyaanubhuutirhi svasaakshikii

'विवेक में द्वैत का मिथ्यात्व केवल युक्ति से ही है' — ऐसा मत कहो; क्योंकि अचिन्त्य रचना का अनुभव तो स्व-साक्षिक है।

Do not say that in discernment the falsity of duality rests on reasoning alone; for the experience of its unthinkable making is witnessed by oneself.

चिदप्यचिन्त्यरचना यदि तर्ह्यस्तु नो वयम्
चितिं सुचिन्त्यरचनां ब्रूमो नित्यत्वकारणात् ॥ २५३ ॥

cidapyacintyaracanā yadi tarhyastu no vayam
citiṃ sucintyaracanāṃ brūmo nityatvakāraṇāt || 253 ||

Chidapyachintyarachanaa yadi tarhyastu no vayam chitim suchintyarachanaam bruumo nityatvakaaranaat

यदि कहो कि चित् भी अचिन्त्य रचना वाली है — तो वैसा ही हो; हम चिति को सुचिन्त्य रचना वाली नहीं कहते, क्योंकि वह नित्य है।

If you say that awareness too is of unthinkable making — let it be so; we do not call awareness a thing of thinkable making, because it is eternal.

प्रागभावो नानुभूतश्चितेर्नित्या ततश्चितिः
द्वैतस्य प्रागभावस्तु चैतन्येनानुभूयते ॥ २५४ ॥

prāgabhāvo nānubhūtaściternityā tataścitiḥ
dvaitasya prāgabhāvastu caitanyenānubhūyate || 254 ||

Praagabhaavo naanubhuutashchiternityaa tatashchitih dvaitasya praagabhaavastu chaitanyenaanubhuuyate

चिति का प्रागभाव अनुभूत नहीं होता, इसलिए चिति नित्य है; पर द्वैत का प्रागभाव चैतन्य के द्वारा अनुभूत होता है।

The prior non-existence of awareness is not experienced, and so awareness is eternal; but the prior non-existence of duality is experienced by awareness.

प्रागभावयुतं द्वैतं रच्यते हि घटादिवत्
तथापि रचनाऽचिन्त्या मिथ्या तेनेन्द्रजालवत् ॥ २५५ ॥

prāgabhāvayutaṃ dvaitaṃ racyate hi ghaṭādivat
tathāpi racanā'cintyā mithyā tenendrajālavat || 255 ||

Praagabhaavayutam dvaitam rachyate hi ghataadivat tathaapi rachanaa'chintyaa mithyaa tenendrajaalavat

प्रागभाव वाला द्वैत घट आदि की तरह रचा जाता है; फिर भी वह रचना अचिन्त्य है, इसलिए इन्द्रजाल की तरह वह मिथ्या है।

Duality, having a prior non-existence, is made as a pot is; yet the making is unthinkable, and so it is false, like a conjuring trick.

चित्प्रत्यक्षा ततोऽन्यस्य मिथ्यात्वं चानुभूयते
नाद्वैतमपरोक्षम् चेत्येतन्न व्याहतं कथम् ॥ २५६ ॥

citpratyakṣā tato'nyasya mithyātvaṃ cānubhūyate
nādvaitamaparokṣam cetyetanna vyāhataṃ katham || 256 ||

Chitpratyakshaa tato'nyasya mithyaatvam chaanubhuuyate naadvaitamaparoksham chetyetanna vyaahatam katham

चित् प्रत्यक्ष है, और उससे अन्य का मिथ्यात्व अनुभूत होता है; तो 'अद्वैत अपरोक्ष नहीं' — यह कथन कैसे विरुद्ध नहीं?

Awareness is directly present, and the falsity of what is other than it is experienced; how then is 'non-duality is not directly present' not a contradiction?

इत्थं ज्ञात्वाप्यसंतुष्टाः केचित्कुत इतीर्यताम्
चार्वाकादेः प्रबुद्धस्यात्मा देहः कुतो वद ॥ २५७ ॥

itthaṃ jñātvāpyasaṃtuṣṭāḥ kecitkuta itīryatām
cārvākādeḥ prabuddhasyātmā dehaḥ kuto vada || 257 ||

Ittham jnaatvaapyasamtushtaah kechitkuta itiiryataam chaarvaakaadeh prabuddhasyaatmaa dehah kuto vada

शङ्का: ऐसा जानकर भी कुछ लोग असन्तुष्ट क्यों रहते हैं? — बताओ, जाग चुके चार्वाक आदि का आत्मा देह क्यों रह जाता है?

An objection: why do some, knowing this, remain unsatisfied? Then tell us why the body remains the Self for a Cārvāka who has been shown better.

सम्यग्विचारो नास्त्यस्य धीदोषादिति चेत्तथा
असन्तुष्टास्तु शास्त्रार्थं न त्वैक्षन्त विशेषतः ॥ २५८ ॥

samyagvicāro nāstyasya dhīdoṣāditi cettathā
asantuṣṭāstu śāstrārthaṃ na tvaikṣanta viśeṣataḥ || 258 ||

Samyagvichaaro naastyasya dhiidoshaaditi chettathaa asantushtaastu shaastraartham na tvaikshanta visheshatah

यदि कहो कि बुद्धि के दोष से उसका सम्यक् विचार नहीं है — तो वैसे ही, असन्तुष्ट लोगों ने भी शास्त्र के अर्थ को विशेष रूप से नहीं देखा।

If you say that through a fault of mind he has not enquired rightly — just so, those who are unsatisfied too have not looked closely into the meaning of scripture.

यदा सर्वे प्रमुच्यन्ते कामा योऽस्य हृदि स्थिताः
इति श्रौतम् फलं दृष्टं नेति चेद्दृष्टमेव तत् ॥ २५९ ॥

yadā sarve pramucyante kāmā yo'sya hṛdi sthitāḥ
iti śrautam phalaṃ dṛṣṭaṃ neti ceddṛṣṭameva tat || 259 ||

Yadaa sarve pramuchyante kaamaa yo'sya hridi sthitaah iti shrautam phalam drishtam neti cheddrishtameva tat

'जब हृदय में स्थित सब कामनाएँ छूट जाती हैं' — यह श्रुति का फल देखा नहीं जाता, यदि कहो — तो वह देखा ही जाता है।

'When all the desires that dwell in his heart are loosed' — if you say that this scriptural fruit is not seen, it is seen indeed.

यदा सर्वे प्रभिद्यन्ते हृदयग्रन्थयस्त्विति
कामा ग्रन्थिस्वरूपेण व्याख्यात वाक्यशेषतः ॥ २६० ॥

yadā sarve prabhidyante hṛdayagranthayastviti
kāmā granthisvarūpeṇa vyākhyāta vākyaśeṣataḥ || 260 ||

Yadaa sarve prabhidyante hridayagranthayastviti kaamaa granthisvaruupena vyaakhyaata vaakyasheshatah

'जब हृदय की सब ग्रन्थियाँ खुल जाती हैं' — वाक्यशेष से कामनाओं की ग्रन्थि-रूपता व्याख्यात हुई।

'When all the knots of the heart are cut' — by the rest of the passage the desires are explained as being in the form of knots.

अहंकारचिदात्मानावेकीकृत्याविवेकतः
इदं मे स्यादिदं मे स्यादितीच्छाः कामशब्दिताः ॥ २६१ ॥

ahaṃkāracidātmānāvekīkṛtyāvivekataḥ
idaṃ me syādidaṃ me syāditīcchāḥ kāmaśabditāḥ || 261 ||

Ahamkaarachidaatmaanaavekiikrityaavivekatah idam me syaadidam me syaaditiichchhaah kaamashabditaah

अहंकार और चिदात्मा को अविवेक से एक करके 'यह मेरा हो, यह मेरा हो' — ऐसी इच्छाएँ 'काम' शब्द से कही जाती हैं।

Making the I-sense and the Self of awareness one through want of discernment, the wishes 'let this be mine, let this be mine' are what the word 'desire' names.

अप्रवेश्य चिदात्मानं पृथक्पश्यन्नहंकृतिम्
इच्छंस्तु कोटिवस्तूनि न बाधो ग्रन्थिभेदतः ॥ २६२ ॥

apraveśya cidātmānaṃ pṛthakpaśyannahaṃkṛtim
icchaṃstu koṭivastūni na bādho granthibhedataḥ || 262 ||

Apraveshya chidaatmaanam prithakpashyannahamkritim ichchhamstu kotivastuuni na baadho granthibhedatah

चिदात्मा को उसमें न घुसाकर, अहंकार को अलग देखता हुआ मनुष्य करोड़ों वस्तुएँ चाहे तो भी कोई बाधा नहीं, क्योंकि ग्रन्थि का भेद हो चुका है।

Not letting the Self of awareness in, and seeing the I-sense as separate, a man may wish for a crore of things and there is no harm, since the knot has been cut.

ग्रन्थिभेदेऽपि संभाव्या इच्छाः प्रारब्धदोषतः
बुद्ध्वापि पापबाहुळ्यादसंतोषो यथा तव ॥ २६३ ॥

granthibhede'pi saṃbhāvyā icchāḥ prārabdhadoṣataḥ
buddhvāpi pāpabāhuḻyādasaṃtoṣo yathā tava || 263 ||

Granthibhede'pi sambhaavyaa ichchhaah praarabdhadoshatah buddhvaapi paapabaahulyaadasamtosho yathaa tava

ग्रन्थि के भेद के बाद भी प्रारब्ध के दोष से इच्छाएँ सम्भव हैं — जैसे जान लेने पर भी पाप की अधिकता से तुम्हारा असन्तोष बना रहता है।

Even after the knot is cut, wishes may arise through the fault of deeds already begun — as your own discontent persists from abundance of wrongdoing, though you know better.

अहंकारगतेच्छाद्यैर्देहव्याध्यादिभिस्तदा
वृक्षादिजन्मनाशैर्वा चिद्रूपात्मनि किं भवेत् ॥ २६४ ॥

ahaṃkāragatecchādyairdehavyādhyādibhistadā
vṛkṣādijanmanāśairvā cidrūpātmani kiṃ bhavet || 264 ||

Ahamkaaragatechchhaadyairdehavyaadhyaadibhistadaa vrikshaadijanmanaashairvaa chidruupaatmani kim bhavet

तब अहंकार में रहने वाली इच्छाओं से, देह की व्याधियों से, या वृक्ष आदि के जन्म-नाश से चिद्रूप आत्मा का क्या बिगड़ता है?

What then can the desires that dwell in the I-sense, or the body's diseases, or the birth and death of trees do to the Self whose nature is awareness?

ग्रन्थिभेदात्पुराप्येवमिति चेत्तन्न विस्मर
अयमेव ग्रन्थिभेदस्तव तेन कृती भवान् ॥ २६५ ॥

granthibhedātpurāpyevamiti cettanna vismara
ayameva granthibhedastava tena kṛtī bhavān || 265 ||

Granthibhedaatpuraapyevamiti chettanna vismara ayameva granthibhedastava tena kritii bhavaan

यदि कहो 'ग्रन्थि के भेद से पहले भी ऐसा ही था' — तो भूलो मत; यही तो तुम्हारा ग्रन्थि-भेद है, और इसी से तुम कृतार्थ हो।

If you say 'it was so even before the knot was cut' — do not forget; this very thing is your cutting of the knot, and by it you are fulfilled.

नैवं जानन्ति मूढाश्चेत्सोऽयं ग्रन्थिर्नचापरः
ग्रन्थितद्भेदमात्रेण वैषम्यं मूढबुद्धयोः ॥ २६६ ॥

naivaṃ jānanti mūḍhāścetso'yaṃ granthirnacāparaḥ
granthitadbhedamātreṇa vaiṣamyaṃ mūḍhabuddhayoḥ || 266 ||

Naivam jaananti muudhaashchetso'yam granthirnachaaparah granthitadbhedamaatrena vaishamyam muudhabuddhayoh

मूढ़ ऐसा नहीं जानते — यही वह ग्रन्थि है, और कोई नहीं; मूढ़ और ज्ञानी में अन्तर केवल ग्रन्थि के होने और कटने का है।

The deluded do not know this — that is the knot and nothing else; the difference between the deluded and the awakened lies only in the knot and its cutting.

प्रवृत्तौ वा निवृत्तौ वा देहेन्द्रियमनोधियाम्
न किंचिदपि वैषम्यमस्त्यज्ञानिविबुद्धयोः ॥ २६७ ॥

pravṛttau vā nivṛttau vā dehendriyamanodhiyām
na kiṃcidapi vaiṣamyamastyajñānivibuddhayoḥ || 267 ||

Pravrittau vaa nivrittau vaa dehendriyamanodhiyaam na kimchidapi vaishamyamastyajnaanivibuddhayoh

देह, इन्द्रिय, मन और बुद्धि की प्रवृत्ति या निवृत्ति में अज्ञानी और ज्ञानी का कोई भी अन्तर नहीं है।

In the engaging or withdrawing of body, organs, mind and understanding there is no difference at all between the ignorant and the awakened.

व्रात्यश्रोत्रिययोर्वेदपाठापाठकृता भिदा
नाहारादावस्ति भेदस्सोऽयं न्यायोऽत्र योज्यताम् ॥ २६८ ॥

vrātyaśrotriyayorvedapāṭhāpāṭhakṛtā bhidā
nāhārādāvasti bhedasso'yaṃ nyāyo'tra yojyatām || 268 ||

Vraatyashrotriyayorvedapaathaapaathakritaa bhidaa naahaaraadaavasti bhedasso'yam nyaayo'tra yojyataam

व्रात्य और श्रोत्रिय में भेद वेद के पढ़ने और न पढ़ने से है, आहार आदि में नहीं; यही न्याय यहाँ लगाना चाहिए।

The difference between the uninitiated and the learned lies in the reciting or not reciting of the Veda, not in food and such; this rule is to be applied here.

न द्वेष्टि संप्रवृत्तानि न निवृत्तानि कांक्षति
उदासीनवदासीन इति ग्रन्थिभिदोच्यते ॥ २६९ ॥

na dveṣṭi saṃpravṛttāni na nivṛttāni kāṃkṣati
udāsīnavadāsīna iti granthibhidocyate || 269 ||

Na dveshti sampravrittaani na nivrittaani kaamkshati udaasiinavadaasiina iti granthibhidochyate

'जो प्रवृत्त हुओं से द्वेष नहीं करता और निवृत्त हुओं की इच्छा नहीं करता, उदासीन की तरह बैठा रहता है' — इसी को ग्रन्थि का भेद कहा जाता है।

'He who does not hate what has come and does not long for what has gone, who sits as one indifferent' — this is what is called the cutting of the knot.

औदासीन्यं विधेयं चेद्वच्छब्दव्यर्थता तदा
न शक्ता अस्य देहाद्य इति चेद्रोग एव सः ॥ २७० ॥

audāsīnyaṃ vidheyaṃ cedvacchabdavyarthatā tadā
na śaktā asya dehādya iti cedroga eva saḥ || 270 ||

Audaasiinyam vidheyam chedvachchhabdavyarthataa tadaa na shaktaa asya dehaadya iti chedroga eva sah

यदि औदासीन्य विधेय हो तो 'वत्' शब्द व्यर्थ हो जाएगा; और यदि कहो कि इसकी देह आदि समर्थ ही नहीं, तो वह तो रोग ही है।

If indifference were something enjoined, the word 'as if' would be useless; and if you say his body and the rest are simply unable, that is just disease.

तत्त्वबोधं क्षयं व्याधिं मन्यन्ते ये महाधियः
तेषां प्रज्ञाऽतिविशदा किं तेषां दुश्शकं वद ॥ २७१ ॥

tattvabodhaṃ kṣayaṃ vyādhiṃ manyante ye mahādhiyaḥ
teṣāṃ prajñā'tiviśadā kiṃ teṣāṃ duśśakaṃ vada || 271 ||

Tattvabodham kshayam vyaadhim manyante ye mahaadhiyah teshaam prajnaa'tivishadaa kim teshaam dushshakam vada

जो महाबुद्धि तत्त्वबोध को क्षयरोग मानते हैं, उनकी प्रज्ञा अत्यन्त निर्मल है — बताओ, उनके लिए क्या कठिन है?

Those great minds who take the knowledge of truth for a wasting disease have a most brilliant wisdom — tell us, what is hard for them?

भरतादेरप्रवृत्तिः पुराणोक्तेति चेत्तदा
जक्षन् क्रीडन् रतिं विंदन्नित्यश्रौषीर्न किं श्रुतिम् ॥ २७२ ॥

bharatāderapravṛttiḥ purāṇokteti cettadā
jakṣan krīḍan ratiṃ viṃdannityaśrauṣīrna kiṃ śrutim || 272 ||

Bharataaderapravrittih puraanokteti chettadaa jakshan kriidan ratim vimdannityashraushiirna kim shrutim

यदि कहो कि भरत आदि की अप्रवृत्ति पुराण में कही गई है — तो 'खाता हुआ, खेलता हुआ, रति पाता हुआ' — यह श्रुति क्या तुमने नहीं सुनी?

If you say that the inactivity of Bharata and the rest is told in the ancient lore — have you not heard the scripture 'eating, playing, taking delight'?

न ह्याहारादि संत्यज्य भरताद्याः स्थिताः क्वचित्
काष्ठपाषाणवत्किम्तु संगभीता उदासते ॥ २७३ ॥

na hyāhārādi saṃtyajya bharatādyāḥ sthitāḥ kvacit
kāṣṭhapāṣāṇavatkimtu saṃgabhītā udāsate || 273 ||

Na hyaahaaraadi samtyajya bharataadyaah sthitaah kvachit kaashthapaashaanavatkimtu samgabhiitaa udaasate

भरत आदि कहीं भी आहार आदि छोड़कर नहीं रहे; वे काठ और पत्थर की तरह नहीं, बल्कि आसक्ति से डरकर उदासीन रहे।

Nowhere did Bharata and the rest live having given up food and the like; they were indifferent not like wood and stone, but from fear of attachment.

संगी हि बाध्यते लोके निस्संगः सुखमश्नुते
तेन संगः परित्याज्यः सर्वदा सुखमिच्छता ॥ २७४ ॥

saṃgī hi bādhyate loke nissaṃgaḥ sukhamaśnute
tena saṃgaḥ parityājyaḥ sarvadā sukhamicchatā || 274 ||

Samgii hi baadhyate loke nissamgah sukhamashnute tena samgah parityaajyah sarvadaa sukhamichchhataa

लोक में आसक्त ही बाधा पाता है, असङ्ग सुख भोगता है; इसलिए सदा सुख चाहने वाले को आसक्ति छोड़ देनी चाहिए।

In the world it is the attached who is hindered, and the unattached who enjoys ease; so one who wants lasting happiness should give up attachment.

अज्ञात्वा शास्त्रहृदयं मूढो वक्त्यन्यथाऽन्यथा
मूर्खाणां निर्णयस्त्वास्तामस्मत्सिद्धान्त उच्यते ॥ २७५ ॥

ajñātvā śāstrahṛdayaṃ mūḍho vaktyanyathā'nyathā
mūrkhāṇāṃ nirṇayastvāstāmasmatsiddhānta ucyate || 275 ||

Ajnaatvaa shaastrahridayam muudho vaktyanyathaa'nyathaa muurkhaanaam nirnayastvaastaamasmatsiddhaanta uchyate

शास्त्र का हृदय न जानकर मूढ़ अलग-अलग बातें कहता है; मूर्खों का निर्णय रहने दो — अब हमारा सिद्धान्त कहा जाता है।

Not knowing the heart of scripture, the dull man says now this, now that; let the conclusions of fools stand aside — our own doctrine is now stated.

वैराग्यबोधोपरमाः सहायास्ते परस्परम्
प्रायेण सह वर्तन्ते वियुज्यन्ते क्वचित् क्वचित् ॥ २७६ ॥

vairāgyabodhoparamāḥ sahāyāste parasparam
prāyeṇa saha vartante viyujyante kvacit kvacit || 276 ||

Vairaagyabodhoparamaah sahaayaaste parasparam praayena saha vartante viyujyante kvachit kvachit

वैराग्य, बोध और उपरति — ये तीनों परस्पर सहायक हैं; प्रायः साथ रहते हैं, और कहीं-कहीं अलग भी हो जाते हैं।

Dispassion, knowledge and cessation help one another; for the most part they go together, and here and there they part.

हेतुस्वरूपकार्याणि भिन्नान्येषामसङ्करः
यथावदवगन्तव्यः शास्त्रार्थं प्रविविच्यताम् ॥ २७७ ॥

hetusvarūpakāryāṇi bhinnānyeṣāmasaṅkaraḥ
yathāvadavagantavyaḥ śāstrārthaṃ pravivicyatām || 277 ||

Hetusvaruupakaaryaani bhinnaanyeshaamasankarah yathaavadavagantavyah shaastraartham pravivichyataam

इनके हेतु, स्वरूप और कार्य भिन्न हैं और मिले हुए नहीं; शास्त्र के अर्थ का विवेचन करते हुए इसे यथावत् समझना चाहिए।

Their causes, their natures and their effects are distinct and unmixed; this should be rightly understood while sifting the meaning of scripture.

दोषदृष्टिर्जिहासा च पुनर्भागेष्वदीनता
असाधारणहेत्वाद्या वैराग्यस्य त्रयोऽप्यमी ॥ २७८ ॥

doṣadṛṣṭirjihāsā ca punarbhāgeṣvadīnatā
asādhāraṇahetvādyā vairāgyasya trayo'pyamī || 278 ||

Doshadrishtirjihaasaa cha punarbhaageshvadiinataa asaadhaaranahetvaadyaa vairaagyasya trayo'pyamii

दोष-दृष्टि, त्याग की इच्छा, और फिर भोगों में दीनता का न होना — ये तीनों क्रमशः वैराग्य के असाधारण हेतु, स्वरूप और कार्य हैं।

Seeing the fault, the wish to abandon, and thereafter no abjectness towards enjoyments — these three are dispassion's special cause, nature and effect.

श्रवणादित्रयं तद्वत्तत्त्वमिथ्याविवेचनम्
पुनर्ग्रन्थेरनुदयो बोधस्यैते त्रयो मताः ॥ २७९ ॥

śravaṇāditrayaṃ tadvattattvamithyāvivecanam
punargrantheranudayo bodhasyaite trayo matāḥ || 279 ||

Shravanaaditrayam tadvattattvamithyaavivechanam punargrantheranudayo bodhasyaite trayo mataah

वैसे ही श्रवण आदि तीन, तत्त्व और मिथ्या का विवेचन, और फिर ग्रन्थि का न उठना — ये तीन बोध के माने गए हैं।

So too the three beginning with hearing, the sifting of the true from the false, and thereafter the knot's not rising again — these three belong to knowledge.

यमादिधीर्निरोधश्च व्यवहारस्य संक्षयः
स्युर्हेत्वाद्या उपरतेरित्यसंकर ईरितः ॥ २८० ॥

yamādidhīrnirodhaśca vyavahārasya saṃkṣayaḥ
syurhetvādyā uparaterityasaṃkara īritaḥ || 280 ||

Yamaadidhiirnirodhashcha vyavahaarasya samkshayah syurhetvaadyaa uparaterityasamkara iiritah

यम आदि, बुद्धि का निरोध, और व्यवहार का क्षय — ये उपरति के हेतु, स्वरूप और कार्य हैं; इस प्रकार इनका न मिलना कहा गया।

The restraints and the rest, the stilling of the understanding, and the wearing away of worldly dealing — these are cessation's cause, nature and effect; thus their unmixedness has been stated.

तत्त्वबोधः प्रधानम् स्यात्साक्षान्मोक्षप्रदत्वतः
बोधोपकारिणावेतौ वैराग्योपरमावुभौ ॥ २८१ ॥

tattvabodhaḥ pradhānam syātsākṣānmokṣapradatvataḥ
bodhopakāriṇāvetau vairāgyoparamāvubhau || 281 ||

Tattvabodhah pradhaanam syaatsaakshaanmokshapradatvatah bodhopakaarinaavetau vairaagyoparamaavubhau

तत्त्वबोध प्रधान है, क्योंकि वह साक्षात् मोक्ष देता है; और वैराग्य तथा उपरति — दोनों बोध के उपकारी हैं।

The knowledge of truth is chief, since it gives release directly; and dispassion and cessation are both helpers of that knowledge.

त्रयोऽप्यत्यन्तपक्वाश्चेन्महतस्तपसः फलम्
दुरितेन क्वचित्किंचित्कदाचित्प्रतिबध्यते ॥ २८२ ॥

trayo'pyatyantapakvāścenmahatastapasaḥ phalam
duritena kvacitkiṃcitkadācitpratibadhyate || 282 ||

Trayo'pyatyantapakvaashchenmahatastapasah phalam duritena kvachitkimchitkadaachitpratibadhyate

यदि तीनों अत्यन्त परिपक्व हों तो वह महान् तप का फल है; कहीं, कुछ, कभी दुरित से रुक भी जाता है।

If all three are fully ripe, that is the fruit of great austerity; here and there, in some measure, now and then, something is hindered by wrongdoing.

वैराग्योपरती पूर्णे बोधस्तु प्रतिबध्यते
यस्य तस्य न मोक्षोऽस्ति पुण्यलोकस्तपोबलात् ॥ २८३ ॥

vairāgyoparatī pūrṇe bodhastu pratibadhyate
yasya tasya na mokṣo'sti puṇyalokastapobalāt || 283 ||

Vairaagyoparatii puurne bodhastu pratibadhyate yasya tasya na moksho'sti punyalokastapobalaat

जिसके वैराग्य और उपरति पूर्ण हों पर बोध में बाधा हो, उसे मोक्ष नहीं मिलता; तप के बल से पुण्यलोक मिलता है।

He whose dispassion and cessation are complete but whose knowledge is hindered does not get release; by the strength of his austerity he gets the worlds of merit.

पूर्णे बोधे तदन्यौ द्वौ प्रतिबद्धौ यदा तदा
मोक्षो विनिश्चितः किन्तु दृष्टदुःखं न नश्यति ॥ २८४ ॥

pūrṇe bodhe tadanyau dvau pratibaddhau yadā tadā
mokṣo viniścitaḥ kintu dṛṣṭaduḥkhaṃ na naśyati || 284 ||

Puurne bodhe tadanyau dvau pratibaddhau yadaa tadaa moksho vinishchitah kintu drishtaduhkham na nashyati

जब बोध पूर्ण हो और शेष दोनों में बाधा हो, तब मोक्ष निश्चित है; किन्तु दिखाई देने वाला दुःख नष्ट नहीं होता।

When knowledge is complete and the other two are hindered, release is certain; but the visible suffering does not cease.

ब्रह्मलोकतृणीकारो वैराग्यस्यावधिर्मतः
देहात्मवत्परात्मत्वदार्ढ्ये बोधस्समाप्यते ॥ २८५ ॥

brahmalokatṛṇīkāro vairāgyasyāvadhirmataḥ
dehātmavatparātmatvadārḍhye bodhassamāpyate || 285 ||

Brahmalokatriniikaaro vairaagyasyaavadhirmatah dehaatmavatparaatmatvadaardhye bodhassamaapyate

ब्रह्मलोक को तृण के समान समझना वैराग्य की सीमा मानी गई है; और देह में आत्मबुद्धि जैसी दृढ़ता परमात्मा में हो जाने पर बोध पूर्ण होता है।

To count the world of Brahmā as a straw is held to be the limit of dispassion; and knowledge is complete when the sense of Self in the supreme is as firm as it is in the body.

सुप्तिवद्विस्मृतिस्सीमा भवेदुपरमस्य हि
दिशाऽनया विनिश्चेयं तारतम्यमवान्तरम् ॥ २८६ ॥

suptivadvismṛtissīmā bhaveduparamasya hi
diśā'nayā viniśceyaṃ tāratamyamavāntaram || 286 ||

Suptivadvismritissiimaa bhaveduparamasya hi dishaa'nayaa vinishcheyam taaratamyamavaantaram

सुषुप्ति की तरह विस्मृति उपरति की सीमा है; इसी दिशा से इनके बीच का तारतम्य निश्चित करना चाहिए।

Forgetfulness like that of deep sleep is the limit of cessation; by this line the gradations between them are to be settled.

आरब्धकर्मनानात्वाद् बुद्धानामन्यथाऽन्यथा
वर्तनं तेन शास्त्रार्थे भ्रमितव्यं न पंडितैः ॥ २८७ ॥

ārabdhakarmanānātvād buddhānāmanyathā'nyathā
vartanaṃ tena śāstrārthe bhramitavyaṃ na paṃḍitaiḥ || 287 ||

Aarabdhakarmanaanaatvaad buddhaanaamanyathaa'nyathaa vartanam tena shaastraarthe bhramitavyam na pamditaih

आरब्ध कर्मों की नानाता से ज्ञानियों का आचरण भिन्न-भिन्न होता है; इसलिए पण्डितों को शास्त्र के अर्थ में भ्रमित नहीं होना चाहिए।

Through the variety of deeds already begun, the conduct of knowers differs from one to another; so the learned should not be confused about the meaning of scripture.

स्वस्वकर्मानुसारेण वर्ततां ते यथा तथा
अवशिष्टस्सर्वबोधः समा मुक्तिरिति स्थितिः ॥ २८८ ॥

svasvakarmānusāreṇa vartatāṃ te yathā tathā
avaśiṣṭassarvabodhaḥ samā muktiriti sthitiḥ || 288 ||

Svasvakarmaanusaarena vartataam te yathaa tathaa avashishtassarvabodhah samaa muktiriti sthitih

वे अपने-अपने कर्म के अनुसार जैसे भी रहें; सबका बोध जो शेष रहता है वह समान है, और मुक्ति भी समान है — यही स्थिति है।

Let them live as their own deeds dictate; the knowledge that remains over is the same in all, and release is the same — such is the settled position.

जगच्चित्रं स्वचैतन्ये पटे चित्रमिवार्पितम्
मायया तदुपेक्ष्यैव चैतन्यं परिशेष्यताम् ॥ २८९ ॥

jagaccitraṃ svacaitanye paṭe citramivārpitam
māyayā tadupekṣyaiva caitanyaṃ pariśeṣyatām || 289 ||

Jagachchitram svachaitanye pate chitramivaarpitam maayayaa tadupekshyaiva chaitanyam parisheshyataam

जगत् का चित्र अपने चैतन्य पर माया से वैसे ही अर्पित है जैसे पट पर चित्र; उसकी उपेक्षा करके चैतन्य को ही शेष रखना चाहिए।

The picture of the world is laid by illusion upon one's own awareness as a picture is laid upon cloth; passing it by, let awareness alone be left over.

चित्रदीपमिमं नित्यं येऽनुसंदधते बुधाः
पश्यन्तोऽपि जगच्चित्रम् ते मुह्यन्ति न पूर्ववत् ॥ २९० ॥

citradīpamimaṃ nityaṃ ye'nusaṃdadhate budhāḥ
paśyanto'pi jagaccitram te muhyanti na pūrvavat || 290 ||

Chitradiipamimam nityam ye'nusamdadhate budhaah pashyanto'pi jagachchitram te muhyanti na puurvavat

जो बुद्धिमान् इस 'चित्रदीप' का नित्य अनुसन्धान करते हैं, वे जगत् के चित्र को देखते हुए भी पहले की तरह मोहित नहीं होते।

The wise who constantly follow out this Lamp of the Picture, though they see the picture of the world, are not deluded as before.

आत्मानं चेद्विजानीयादयमस्मीति पूरुषः
किमिच्छन् कस्य कामाय शरीरमनुसंज्वरेत् ॥ १ ॥

ātmānaṃ cedvijānīyādayamasmīti pūruṣaḥ
kimicchan kasya kāmāya śarīramanusaṃjvaret || 1 ||

Aatmaanam chedvijaaniiyaadayamasmiiti puurushah kimichchhan kasya kaamaaya shariiramanusamjvaret

'यदि पुरुष आत्मा को 'यह मैं हूँ' इस रूप में जान ले, तो वह क्या चाहता हुआ और किसकी कामना के लिए शरीर के पीछे तपे?'

'If a man should know the Self as “this am I”, then wishing what and for whose desire should he burn after the body?'

अस्याः श्रुतेरभिप्रायः सम्यगत्र विचार्यते
जीवन्मुक्तस्य या तृप्तिः सा तेन विशदायते ॥ २ ॥

asyāḥ śruterabhiprāyaḥ samyagatra vicāryate
jīvanmuktasya yā tṛptiḥ sā tena viśadāyate || 2 ||

Asyaah shruterabhipraayah samyagatra vichaaryate jiivanmuktasya yaa triptih saa tena vishadaayate

इस श्रुति का अभिप्राय यहाँ भलीभाँति विचारा जाता है; जीवन्मुक्त की जो तृप्ति है, वह इससे स्पष्ट हो जाती है।

The purport of this scripture is here duly weighed; and by it the contentment of one free while living becomes clear.

मायाभासेन जीवेशौ करोतीति श्रुतत्वतः
कल्पितावेव जीवेशौ ताभ्यां सर्वं प्रकल्पितम् ॥ ३ ॥

māyābhāsena jīveśau karotīti śrutatvataḥ
kalpitāveva jīveśau tābhyāṃ sarvaṃ prakalpitam || 3 ||

Maayaabhaasena jiiveshau karotiiti shrutatvatah kalpitaaveva jiiveshau taabhyaam sarvam prakalpitam

'माया के आभास से वह जीव और ईश्वर को बनाता है' — ऐसा सुना गया है; इसलिए जीव और ईश्वर कल्पित ही हैं, और उन दोनों से सब कुछ कल्पित है।

'By the reflection in illusion he makes soul and Lord' — so it is heard; therefore soul and Lord are themselves imagined, and by those two all else is imagined.

ईक्षणादिप्रवेशान्ता सृष्टिरीशेन कल्पिता
जाग्रदादिविमोक्षान्तः संसारो जीवकल्पितः ॥ ४ ॥

īkṣaṇādipraveśāntā sṛṣṭirīśena kalpitā
jāgradādivimokṣāntaḥ saṃsāro jīvakalpitaḥ || 4 ||

Iikshanaadipraveshaantaa srishtiriishena kalpitaa jaagradaadivimokshaantah samsaaro jiivakalpitah

ईक्षण से प्रवेश तक की सृष्टि ईश्वर ने कल्पित की है; और जाग्रत् से मोक्ष तक का संसार जीव ने कल्पित किया है।

The creation from the first looking to the entering is imagined by the Lord; the round from waking to release is imagined by the soul.

भ्रमाधिष्ठानभूतात्मा कूटस्थासंगचिद्वपुः
अन्योन्याध्यासतोऽसंगधीस्थजीवोऽत्र पूरुषः ॥ ५ ॥

bhramādhiṣṭhānabhūtātmā kūṭasthāsaṃgacidvapuḥ
anyonyādhyāsato'saṃgadhīsthajīvo'tra pūruṣaḥ || 5 ||

Bhramaadhishthaanabhuutaatmaa kuutasthaasamgachidvapuh anyonyaadhyaasato'samgadhiisthajiivo'tra puurushah

भ्रम का अधिष्ठान आत्मा है, जो कूटस्थ, असङ्ग और चित्-स्वरूप है; अन्योन्याध्यास से असङ्ग में बुद्धिस्थ जीव — यही यहाँ 'पुरुष' है।

The ground of the error is the Self, unchanging, unattached and of the nature of awareness; by mutual superimposition the soul seated in the understanding upon the unattached — that is the 'man' here.

साधिष्ठानो विमोक्षादौ जीवो विक्रियते न तु
केवलो निरधिष्ठानविभ्रान्तेः क्वाप्यसिद्धितः ॥ ६ ॥

sādhiṣṭhāno vimokṣādau jīvo vikriyate na tu
kevalo niradhiṣṭhānavibhrānteḥ kvāpyasiddhitaḥ || 6 ||

Saadhishthaano vimokshaadau jiivo vikriyate na tu kevalo niradhishthaanavibhraanteh kvaapyasiddhitah

अधिष्ठान सहित जीव ही मोक्ष आदि में विकृत होता है, केवल जीव नहीं; क्योंकि अधिष्ठान के बिना भ्रान्ति कहीं सिद्ध नहीं होती।

It is the soul together with its ground that undergoes change in release and the rest, not the soul alone; for nowhere is an error established without a ground.

अधिष्ठानांशसंयुक्तं भ्रमांशमवलंबते
यदा तदाहं संसारीत्येवं जीवोऽभिमन्यते ॥ ७ ॥

adhiṣṭhānāṃśasaṃyuktaṃ bhramāṃśamavalaṃbate
yadā tadāhaṃ saṃsārītyevaṃ jīvo'bhimanyate || 7 ||

Adhishthaanaamshasamyuktam bhramaamshamavalambate yadaa tadaaham samsaariityevam jiivo'bhimanyate

जब वह अधिष्ठान के अंश से युक्त होकर भ्रम के अंश का अवलम्बन करता है, तब जीव 'मैं संसारी हूँ' ऐसा अभिमान करता है।

When, joined with the portion that is the ground, it leans on the portion that is error, the soul thinks 'I am one caught in the world'.

भ्रमांशस्य तिरस्कारादधिष्ठानप्रधानता
यदा तदा चिदात्माऽहमसंगोऽस्मीति बुध्यते ॥ ८ ॥

bhramāṃśasya tiraskārādadhiṣṭhānapradhānatā
yadā tadā cidātmā'hamasaṃgo'smīti budhyate || 8 ||

Bhramaamshasya tiraskaaraadadhishthaanapradhaanataa yadaa tadaa chidaatmaa'hamasamgo'smiiti budhyate

जब भ्रम का अंश तिरस्कृत हो जाता है और अधिष्ठान प्रधान हो जाता है, तब वह जानता है — 'मैं चिदात्मा हूँ, असङ्ग हूँ'।

When the portion that is error is set aside and the ground becomes chief, then it knows, 'I am the Self of awareness, I am unattached'.

नासंगेऽहंकृतिर्युक्ता कथमस्मीति चेच्छृणु
एको मुख्यो द्वावमुख्यावित्यर्थस्त्रिविधोऽहमः ॥ ९ ॥

nāsaṃge'haṃkṛtiryuktā kathamasmīti cecchṛṇu
eko mukhyo dvāvamukhyāvityarthastrividho'hamaḥ || 9 ||

Naasamge'hamkritiryuktaa kathamasmiiti chechchhrinu eko mukhyo dvaavamukhyaavityarthastrividho'hamah

यदि कहो कि असङ्ग में 'अहम्' का प्रयोग उचित नहीं, तो 'मैं हूँ' कैसे कहा जाए — सुनो: 'अहम्' का अर्थ तीन प्रकार का है — एक मुख्य और दो अमुख्य।

If you say the I-sense does not fit the unattached, and ask how 'I am' can be said — listen: the meaning of 'I' is of three kinds, one primary and two secondary.

अन्योन्याध्यासरूपेण कूटस्थाभासयोर्वपुः
एकीभूय भवेन्मुख्यस्तत्र मूढैः प्रयुज्यते ॥ १० ॥

anyonyādhyāsarūpeṇa kūṭasthābhāsayorvapuḥ
ekībhūya bhavenmukhyastatra mūḍhaiḥ prayujyate || 10 ||

Anyonyaadhyaasaruupena kuutasthaabhaasayorvapuh ekiibhuuya bhavenmukhyastatra muudhaih prayujyate

अन्योन्याध्यास के रूप में कूटस्थ और आभास का शरीर एक होकर मुख्य 'अहम्' बनता है; वहाँ मूढ़ लोग इसका प्रयोग करते हैं।

By mutual superimposition the bodies of the unchanging one and of the reflection become one, and that is the primary 'I'; there the deluded use the word.

पृथगाभासकूटस्थावमुख्यौ तत्र तत्त्ववित्
पर्यायेण प्रयुङ्क्तेऽहंशब्दं लोके च वैदिके ॥ ११ ॥

pṛthagābhāsakūṭasthāvamukhyau tatra tattvavit
paryāyeṇa prayuṅkte'haṃśabdaṃ loke ca vaidike || 11 ||

Prithagaabhaasakuutasthaavamukhyau tatra tattvavit paryaayena prayunkte'hamshabdam loke cha vaidike

अलग-अलग आभास और कूटस्थ — ये दोनों अमुख्य हैं; वहाँ तत्त्ववेत्ता लोक में और वेद में बारी-बारी से 'अहम्' शब्द का प्रयोग करता है।

The reflection and the unchanging one taken apart are the two secondary meanings; there the knower of truth uses the word 'I' by turns, in worldly and in scriptural speech.

लौकिकव्यवहारेऽहं गच्छामीत्यादिके बुधः
विविच्यैव चिदाभासं कूटस्थात्तं विवक्षति ॥ १२ ॥

laukikavyavahāre'haṃ gacchāmītyādike budhaḥ
vivicyaiva cidābhāsaṃ kūṭasthāttaṃ vivakṣati || 12 ||

Laukikavyavahaare'ham gachchhaamiityaadike budhah vivichyaiva chidaabhaasam kuutasthaattam vivakshati

'मैं जाता हूँ' आदि लौकिक व्यवहार में विद्वान् चिदाभास को कूटस्थ से अलग करके उसी (चिदाभास) को कहना चाहता है।

In worldly dealings like 'I go', the wise man, having separated the reflection of awareness from the unchanging one, means the reflection.

असंगोऽहं चिदात्माऽहमिति शास्त्रीयदृष्टितः
अहंशब्दं प्रयुङ्क्तेऽयं कूटस्थे केवले बुधः ॥ १३ ॥

asaṃgo'haṃ cidātmā'hamiti śāstrīyadṛṣṭitaḥ
ahaṃśabdaṃ prayuṅkte'yaṃ kūṭasthe kevale budhaḥ || 13 ||

Asamgo'ham chidaatmaa'hamiti shaastriiyadrishtitah ahamshabdam prayunkte'yam kuutasthe kevale budhah

'मैं असङ्ग हूँ, मैं चिदात्मा हूँ' — इस शास्त्रीय दृष्टि से यह विद्वान् केवल कूटस्थ में 'अहम्' शब्द का प्रयोग करता है।

'I am unattached, I am the Self of awareness' — with this scriptural view the wise man uses the word 'I' of the unchanging one alone.

ज्ञानिताज्ञानिते त्वात्माभासस्यैव न चात्मनः
तथा च कथमाभासः कूटस्थोऽस्मीति बुध्यताम् ॥ १४ ॥

jñānitājñānite tvātmābhāsasyaiva na cātmanaḥ
tathā ca kathamābhāsaḥ kūṭastho'smīti budhyatām || 14 ||

Jnaanitaajnaanite tvaatmaabhaasasyaiva na chaatmanah tathaa cha kathamaabhaasah kuutastho'smiiti budhyataam

शङ्का: ज्ञानी और अज्ञानी होना तो आत्माभास का ही है, आत्मा का नहीं; तो आभास 'मैं कूटस्थ हूँ' ऐसा कैसे जाने?

An objection: being a knower or not knowing belongs to the reflection, not to the Self; how then should the reflection know 'I am the unchanging one'?

नायं दोषश्चिदाभासः कूटस्थैकस्वभाववान्
आभासत्वस्य मिथ्यात्वात्कूटस्थत्वावशेषणात् ॥ १५ ॥

nāyaṃ doṣaścidābhāsaḥ kūṭasthaikasvabhāvavān
ābhāsatvasya mithyātvātkūṭasthatvāvaśeṣaṇāt || 15 ||

Naayam doshashchidaabhaasah kuutasthaikasvabhaavavaan aabhaasatvasya mithyaatvaatkuutasthatvaavasheshanaat

उत्तर: यह दोष नहीं; चिदाभास का एक ही स्वभाव कूटस्थ है, क्योंकि आभासपन मिथ्या है और कूटस्थपन ही शेष रहता है।

The answer: this is no fault; the one nature of the reflection is the unchanging one, since its being a reflection is false and only its being the unchanging one is left.

कूटस्थोऽस्मीति बोधोपि मिथ्या चेन्नेति को वदेत्
न हि सत्यतयाऽभीष्टं रज्जुसर्पविसर्पणम् ॥ १६ ॥

kūṭastho'smīti bodhopi mithyā cenneti ko vadet
na hi satyatayā'bhīṣṭaṃ rajjusarpavisarpaṇam || 16 ||

Kuutastho'smiiti bodhopi mithyaa chenneti ko vadet na hi satyatayaa'bhiishtam rajjusarpavisarpanam

यदि कहो कि 'मैं कूटस्थ हूँ' यह बोध भी मिथ्या है — तो कौन कहता है कि नहीं? रस्सी में साँप का फैलना भी सत्य रूप से अभीष्ट नहीं है।

If you say that the knowledge 'I am the unchanging one' is itself false — who says it is not? The snake's spreading on the rope is not wanted as real either.

तादृशेनापि बोधेन संसारो हि निवर्तते
यक्षानुरूपो हि बलिरित्याहुर्लौकिका जनाः ॥ १७ ॥

tādṛśenāpi bodhena saṃsāro hi nivartate
yakṣānurūpo hi balirityāhurlaukikā janāḥ || 17 ||

Taadrishenaapi bodhena samsaaro hi nivartate yakshaanuruupo hi balirityaahurlaukikaa janaah

ऐसे बोध से भी संसार निवृत्त हो जाता है; लोक में कहते हैं — 'जैसा यक्ष, वैसी बलि'।

By such a knowledge too the round of the world ceases; as men say in the world, 'the offering matches the spirit'.

तस्मादाभासपुरुषः स कूटस्थो विविच्य तम्
कूटस्थोऽस्मीति विज्ञातुमर्हतीत्यभ्यधाच्छ्रुतिः ॥ १८ ॥

tasmādābhāsapuruṣaḥ sa kūṭastho vivicya tam
kūṭastho'smīti vijñātumarhatītyabhyadhācchrutiḥ || 18 ||

Tasmaadaabhaasapurushah sa kuutastho vivichya tam kuutastho'smiiti vijnaatumarhatiityabhyadhaachchhrutih

इसलिए आभास-पुरुष उस कूटस्थ को अलग करके 'मैं कूटस्थ हूँ' — ऐसा जानने योग्य है; यही श्रुति ने कहा।

Therefore the man who is the reflection, having distinguished the unchanging one, is fit to know 'I am the unchanging one'; so scripture has said.

असंदिग्धाविपर्यस्तबोधो देहात्मनीक्ष्यते
तद्वदत्रेति निर्णेतुमयमित्यभिधीयते ॥ १९ ॥

asaṃdigdhāviparyastabodho dehātmanīkṣyate
tadvadatreti nirṇetumayamityabhidhīyate || 19 ||

Asamdigdhaaviparyastabodho dehaatmaniikshyate tadvadatreti nirnetumayamityabhidhiiyate

असंदिग्ध और अविपरीत बोध देह में आत्मा के विषय में देखा जाता है; यहाँ भी वैसा ही हो — यह निश्चित करने के लिए 'अयम्' कहा गया।

A knowledge free of doubt and of error is seen in the case of the Self as the body; to settle that it should be so here too, the word 'this' is used.

देहात्मज्ञानवत् ज्ञानं देहात्मज्ञानबाधकम्
आत्मन्येव भवेद्यस्य स नेच्छन्नपि मुच्यते ॥ २० ॥

dehātmajñānavat jñānaṃ dehātmajñānabādhakam
ātmanyeva bhavedyasya sa necchannapi mucyate || 20 ||

Dehaatmajnaanavat jnaanam dehaatmajnaanabaadhakam aatmanyeva bhavedyasya sa nechchhannapi muchyate

देह में आत्मबुद्धि जैसा, और देह-आत्म-ज्ञान का बाधक ज्ञान जिसे आत्मा में ही हो जाए, वह न चाहते हुए भी मुक्त हो जाता है।

He in whom there arises, about the Self, a knowledge like the sense of self in the body and destroying that sense, is freed even without wishing it.

अयमित्यपरोक्षत्वमुच्यते चेत्तदुच्यताम्
स्वयंप्रकाशचैतन्यमपरोक्षं सदा यतः ॥ २१ ॥

ayamityaparokṣatvamucyate cettaducyatām
svayaṃprakāśacaitanyamaparokṣaṃ sadā yataḥ || 21 ||

Ayamityaparokshatvamuchyate chettaduchyataam svayamprakaashachaitanyamaparoksham sadaa yatah

यदि कहो कि 'अयम्' से अपरोक्षता कही जाती है — तो कही जाए; क्योंकि स्वयंप्रकाश चैतन्य तो सदा अपरोक्ष ही है।

If you say that by 'this' its direct presence is meant — let it be so said; for self-luminous awareness is always directly present.

परोक्षमपरोक्षं च ज्ञानमज्ञानमित्यदः
नित्यापरोक्षरूपेऽपि द्वयं स्याद्दशमे यथा ॥ २२ ॥

parokṣamaparokṣaṃ ca jñānamajñānamityadaḥ
nityāparokṣarūpe'pi dvayaṃ syāddaśame yathā || 22 ||

Parokshamaparoksham cha jnaanamajnaanamityadah nityaaparoksharuupe'pi dvayam syaaddashame yathaa

ज्ञान परोक्ष और अपरोक्ष होता है, और अज्ञान भी; नित्य अपरोक्ष वस्तु में भी दोनों हो सकते हैं — जैसे दसवें के दृष्टान्त में।

Knowledge is indirect and direct, and so is ignorance; both can be about what is always directly present — as in the case of the tenth man.

नवसंख्याहृतज्ञाने दशमो विभ्रमात्तदा
न वेत्ति दशमोऽस्मीति वीक्षमाणोऽपि तान्नव ॥ २३ ॥

navasaṃkhyāhṛtajñāne daśamo vibhramāttadā
na vetti daśamo'smīti vīkṣamāṇo'pi tānnava || 23 ||

Navasamkhyaahritajnaane dashamo vibhramaattadaa na vetti dashamo'smiiti viikshamaano'pi taannava

नौ की गिनती में ज्ञान हर लिए जाने पर दसवाँ उस समय भ्रम से, उन नौ को देखते हुए भी, यह नहीं जानता कि 'मैं दसवाँ हूँ'।

His knowledge carried off by the count of nine, the tenth man then, through error, does not know 'I am the tenth', though he sees those nine.

न भाति नास्ति दशम इति स्वं दशमं तथा
मत्वा वक्ति तदज्ञानकृतमावरणं विदुः ॥ २४ ॥

na bhāti nāsti daśama iti svaṃ daśamaṃ tathā
matvā vakti tadajñānakṛtamāvaraṇaṃ viduḥ || 24 ||

Na bhaati naasti dashama iti svam dashamam tathaa matvaa vakti tadajnaanakritamaavaranam viduh

'दसवाँ न भासता है, न है' — ऐसा अपने को ही दसवाँ मानकर वह कहता है; इसे विद्वान् अज्ञान से किया हुआ आवरण कहते हैं।

'The tenth does not appear, the tenth is not' — so he says of himself, who is the tenth; the wise call this the covering made by ignorance.

नद्यां ममार दशम इति शोचन् प्ररोदिति
अज्ञानकृतविक्षेपं रोदनादिं विदुर्बुधाः ॥ २५ ॥

nadyāṃ mamāra daśama iti śocan praroditi
ajñānakṛtavikṣepaṃ rodanādiṃ vidurbudhāḥ || 25 ||

Nadyaam mamaara dashama iti shochan praroditi ajnaanakritavikshepam rodanaadim vidurbudhaah

'दसवाँ नदी में मर गया' — ऐसा शोक करके वह रोने लगता है; रोना आदि को बुद्धिमान् अज्ञान से किया हुआ विक्षेप कहते हैं।

'The tenth has drowned in the river' — so grieving he weeps; the wise call weeping and the rest the projection made by ignorance.

न मृतो दशमोऽस्तीति श्रुत्वाऽप्तवचनं तदा
परोक्षत्वेन दशमं वेत्ति स्वर्गादिलोकवत् ॥ २६ ॥

na mṛto daśamo'stīti śrutvā'ptavacanaṃ tadā
parokṣatvena daśamaṃ vetti svargādilokavat || 26 ||

Na mrito dashamo'stiiti shrutvaa'ptavachanam tadaa parokshatvena dashamam vetti svargaadilokavat

'दसवाँ मरा नहीं, है' — यह आप्त का वचन सुनकर वह दसवें को परोक्ष रूप से जानता है, जैसे स्वर्ग आदि लोकों को।

Hearing a trustworthy man say 'the tenth is not dead, he is', he knows the tenth indirectly, as one knows heaven and the other worlds.

त्वमेव दशमोऽसीति गणयित्वा प्रदर्शितः
अपरोक्षतया ज्ञात्वा हृष्यत्येव न रोदिति ॥ २७ ॥

tvameva daśamo'sīti gaṇayitvā pradarśitaḥ
aparokṣatayā jñātvā hṛṣyatyeva na roditi || 27 ||

Tvameva dashamo'siiti ganayitvaa pradarshitah aparokshatayaa jnaatvaa hrishyatyeva na roditi

'तू ही दसवाँ है' — ऐसा गिनकर दिखाए जाने पर, अपरोक्ष रूप से जानकर वह हर्षित ही होता है, रोता नहीं।

When by counting it is shown him 'thou art the tenth', he knows it directly and is glad, and does not weep.

अज्ञानावृतिविक्षेपद्विविधज्ञानतृप्तयः
शोकापगम इत्येते योजनीयाश्चिदात्मनि ॥ २८ ॥

ajñānāvṛtivikṣepadvividhajñānatṛptayaḥ
śokāpagama ityete yojanīyāścidātmani || 28 ||

Ajnaanaavritivikshepadvividhajnaanatriptayah shokaapagama ityete yojaniiyaashchidaatmani

अज्ञान, आवरण, विक्षेप, दो प्रकार का ज्ञान, तृप्ति और शोक का जाना — इन्हें चिदात्मा में लगाना चाहिए।

Ignorance, covering, projection, knowledge of two kinds, contentment, and the going of grief — these are to be applied to the Self of awareness.

संसारासक्तचित्तः संश्चिदाभासः कदाचन
स्वयंप्रकाशकूटस्थं स्वतत्वं नैव वेत्त्ययम् ॥ २९ ॥

saṃsārāsaktacittaḥ saṃścidābhāsaḥ kadācana
svayaṃprakāśakūṭasthaṃ svatatvaṃ naiva vettyayam || 29 ||

Samsaaraasaktachittah samshchidaabhaasah kadaachana svayamprakaashakuutastham svatatvam naiva vettyayam

संसार में आसक्त चित्त वाला यह चिदाभास कभी भी स्वयंप्रकाश कूटस्थ अपने तत्त्व को नहीं जानता।

This reflection of awareness, its mind attached to the world, never knows its own reality, the self-luminous unchanging one.

न भाति नास्ति कूटस्थ इति वक्ति प्रसंगतः
कर्ता भोक्ताऽहमस्मीति विक्षेपं प्रतिपद्यते ॥ ३० ॥

na bhāti nāsti kūṭastha iti vakti prasaṃgataḥ
kartā bhoktā'hamasmīti vikṣepaṃ pratipadyate || 30 ||

Na bhaati naasti kuutastha iti vakti prasamgatah kartaa bhoktaa'hamasmiiti vikshepam pratipadyate

प्रसंग आने पर वह कहता है 'कूटस्थ न भासता है, न है'; और 'मैं कर्ता हूँ, भोक्ता हूँ' — इस विक्षेप को प्राप्त होता है।

On occasion he says, 'the unchanging one does not appear, is not'; and he falls into the projection 'I am the doer, I am the enjoyer'.

अस्ति कूटस्थ इत्यादौ परोक्षम् वेत्ति वार्तया
पश्चात्कूटस्थ एवास्मीत्येवं वेत्ति विचारतः ॥ ३१ ॥

asti kūṭastha ityādau parokṣam vetti vārtayā
paścātkūṭastha evāsmītyevaṃ vetti vicārataḥ || 31 ||

Asti kuutastha ityaadau paroksham vetti vaartayaa pashchaatkuutastha evaasmiityevam vetti vichaaratah

पहले सुनी हुई बात से 'कूटस्थ है' — इस प्रकार परोक्ष रूप से जानता है; बाद में विचार से 'मैं ही कूटस्थ हूँ' — ऐसा जानता है।

First, from what he has heard, he knows indirectly 'the unchanging one is'; afterwards, by enquiry, he knows 'I myself am the unchanging one'.

कर्ता भोक्तेत्येवमादिशोकजातं प्रमुंचति
कृतं कृत्यं प्रापणीयं प्राप्तमित्येव तुष्यति ॥ ३२ ॥

kartā bhoktetyevamādiśokajātaṃ pramuṃcati
kṛtaṃ kṛtyaṃ prāpaṇīyaṃ prāptamityeva tuṣyati || 32 ||

Kartaa bhoktetyevamaadishokajaatam pramumchati kritam krityam praapaniiyam praaptamityeva tushyati

'मैं कर्ता हूँ, भोक्ता हूँ' आदि सारे शोक को वह छोड़ देता है, और 'जो करना था वह हो गया, जो पाना था वह मिल गया' — ऐसा मानकर सन्तुष्ट होता है।

He lets go all the grief of 'I am doer, I am enjoyer', and is content, thinking 'what was to be done is done, what was to be got is got'.

अज्ञानमावृतिस्तद्वद्विक्षेपश्च परोक्षधीः
अपरोक्षमतिः शोकमोक्षस्तृप्तिर्निरंकुशा ॥ ३३ ॥

ajñānamāvṛtistadvadvikṣepaśca parokṣadhīḥ
aparokṣamatiḥ śokamokṣastṛptirniraṃkuśā || 33 ||

Ajnaanamaavritistadvadvikshepashcha parokshadhiih aparokshamatih shokamokshastriptirniramkushaa

अज्ञान, आवरण, वैसे ही विक्षेप, परोक्ष बुद्धि, अपरोक्ष बुद्धि, शोक से मुक्ति, और निरंकुश तृप्ति —

Ignorance, covering, likewise projection, indirect knowledge, direct knowledge, freedom from grief, and unbounded contentment —

सप्तावस्था इमाः सन्ति चिदाभासस्य तास्विमौ
बंधमोक्षौ स्थितौ तत्र तिस्रो बंधकृताः स्मृताः ॥ ३४ ॥

saptāvasthā imāḥ santi cidābhāsasya tāsvimau
baṃdhamokṣau sthitau tatra tisro baṃdhakṛtāḥ smṛtāḥ || 34 ||

Saptaavasthaa imaah santi chidaabhaasasya taasvimau bamdhamokshau sthitau tatra tisro bamdhakritaah smritaah

— ये चिदाभास की सात अवस्थाएँ हैं; इन्हीं में बन्ध और मोक्ष स्थित हैं, और इनमें पहली तीन बन्ध करने वाली मानी गई हैं।

— these are the seven states of the reflection of awareness; in them stand bondage and release, and of them the first three are held to make bondage.

न जानामीत्युदासीनव्यवहारस्य कारणम्
विचारप्रागभावेन युक्तमज्ञानमीरितम् ॥ ३५ ॥

na jānāmītyudāsīnavyavahārasya kāraṇam
vicāraprāgabhāvena yuktamajñānamīritam || 35 ||

Na jaanaamiityudaasiinavyavahaarasya kaaranam vichaarapraagabhaavena yuktamajnaanamiiritam

'मैं नहीं जानता' — इस उदासीन व्यवहार का कारण, विचार के प्रागभाव के साथ, अज्ञान ही उचित कहा गया है।

'I do not know' — the cause of this indifferent way of speaking, together with the prior absence of enquiry, is rightly said to be ignorance.

अमार्गेण विचार्याथ नास्ति नो भाति चेत्यसौ
विपरीतव्यवहृतिरावृतेः कार्यमिष्यते ॥ ३६ ॥

amārgeṇa vicāryātha nāsti no bhāti cetyasau
viparītavyavahṛtirāvṛteḥ kāryamiṣyate || 36 ||

Amaargena vichaaryaatha naasti no bhaati chetyasau vipariitavyavahritiraavriteh kaaryamishyate

फिर गलत मार्ग से विचार करके 'नहीं है, नहीं भासता' — यह विपरीत व्यवहार आवरण का कार्य माना जाता है।

Then, enquiring by a wrong path, 'it is not, it does not appear' — this contrary way of speaking is held to be the work of the covering.

देहद्वयचिदाभासरूपो विक्षेप ईरितः
कर्तृत्वाद्यखिलः शोकः संसाराख्योऽस्य बंधकः ॥ ३७ ॥

dehadvayacidābhāsarūpo vikṣepa īritaḥ
kartṛtvādyakhilaḥ śokaḥ saṃsārākhyo'sya baṃdhakaḥ || 37 ||

Dehadvayachidaabhaasaruupo vikshepa iiritah kartritvaadyakhilah shokah samsaaraakhyo'sya bamdhakah

दोनों देहों और चिदाभास के रूप वाला विक्षेप कहा गया है; कर्तृत्व आदि सारा शोक, जिसका नाम संसार है, इसी का बन्धन है।

The projection is said to be in the form of the two bodies and the reflection of awareness; the whole grief of doership and the rest, named the round of the world, is its bondage.

अज्ञानमावृतिश्चैते विक्षेपात्प्राक्प्रसिध्यतः
यद्यप्यथाप्यवस्थे ते विक्षेपस्यैव नात्मनः ॥ ३८ ॥

ajñānamāvṛtiścaite vikṣepātprākprasidhyataḥ
yadyapyathāpyavasthe te vikṣepasyaiva nātmanaḥ || 38 ||

Ajnaanamaavritishchaite vikshepaatpraakprasidhyatah yadyapyathaapyavasthe te vikshepasyaiva naatmanah

यद्यपि अज्ञान और आवरण विक्षेप से पहले सिद्ध होते हैं, तथापि वे विक्षेप की ही अवस्थाएँ हैं, आत्मा की नहीं।

Though ignorance and the covering are established before projection, yet they are states of projection itself and not of the Self.

विक्षेपोत्पत्तितः पूर्वमपि विक्षेपसंस्कृतिः
अस्त्येव तदवस्थात्वमविरुद्धं ततस्तयोः ॥ ३९ ॥

vikṣepotpattitaḥ pūrvamapi vikṣepasaṃskṛtiḥ
astyeva tadavasthātvamaviruddhaṃ tatastayoḥ || 39 ||

Vikshepotpattitah puurvamapi vikshepasamskritih astyeva tadavasthaatvamaviruddham tatastayoh

विक्षेप की उत्पत्ति से पहले भी विक्षेप का संस्कार रहता ही है; इसलिए उन दोनों का उसकी अवस्था होना विरुद्ध नहीं।

Even before projection arises, the impression of projection is there; so their being states of it is not inconsistent.

ब्रह्मण्यारोपितत्वेन ब्रह्मावस्थे इमे इति
न शंकनीयं सर्वासां ब्रह्मण्येवाधिरोपणात् ॥ ४० ॥

brahmaṇyāropitatvena brahmāvasthe ime iti
na śaṃkanīyaṃ sarvāsāṃ brahmaṇyevādhiropaṇāt || 40 ||

Brahmanyaaropitatvena brahmaavasthe ime iti na shamkaniiyam sarvaasaam brahmanyevaadhiropanaat

ब्रह्म पर आरोपित होने से ये ब्रह्म की अवस्थाएँ हैं — ऐसी शङ्का नहीं करनी चाहिए, क्योंकि सब कुछ ब्रह्म पर ही आरोपित है।

It should not be suspected that, being superimposed on Brahman, these are states of Brahman; for everything alike is superimposed on Brahman.

संसार्यहं विबुद्धोहं निःशोकस्तुष्ट इत्यपि
जीवगा उत्तरावस्था भान्ति न ब्रह्मगा यदि ॥ ४१ ॥

saṃsāryahaṃ vibuddhohaṃ niḥśokastuṣṭa ityapi
jīvagā uttarāvasthā bhānti na brahmagā yadi || 41 ||

Samsaaryaham vibuddhoham nihshokastushta ityapi jiivagaa uttaraavasthaa bhaanti na brahmagaa yadi

यदि 'मैं संसारी हूँ', 'मैं जाग गया', 'मैं शोकरहित हूँ', 'मैं सन्तुष्ट हूँ' — ये बाद की अवस्थाएँ जीव की ही भासती हैं, ब्रह्म की नहीं —

If 'I am in the world', 'I have awakened', 'I am free of grief', 'I am content' — these later states appear as the soul's, not as Brahman's —

तर्ह्यज्ञोऽहं ब्रह्मसत्वभाने मद्दृष्टितो न हि
इति पूर्वे अवस्थे च भासेते जीवगे खलु ॥ ४२ ॥

tarhyajño'haṃ brahmasatvabhāne maddṛṣṭito na hi
iti pūrve avasthe ca bhāsete jīvage khalu || 42 ||

Tarhyajno'ham brahmasatvabhaane maddrishtito na hi iti puurve avasthe cha bhaasete jiivage khalu

तो 'मैं अज्ञ हूँ', 'ब्रह्म के होने का भान मेरी दृष्टि से नहीं होता' — ये पहली दोनों अवस्थाएँ भी जीव की ही भासती हैं।

Then 'I am one who does not know', 'the being of Brahman does not appear to my seeing' — these first two states too appear as the soul's.

अज्ञानस्याश्रयो ब्रह्मेत्यधिष्ठानतया जगुः
जीवावस्थात्वमज्ञानाभिमानित्वादवादिषम् ॥ ४३ ॥

ajñānasyāśrayo brahmetyadhiṣṭhānatayā jaguḥ
jīvāvasthātvamajñānābhimānitvādavādiṣam || 43 ||

Ajnaanasyaashrayo brahmetyadhishthaanatayaa jaguh jiivaavasthaatvamajnaanaabhimaanitvaadavaadisham

अज्ञान का आश्रय ब्रह्म है — यह अधिष्ठान होने के नाते कहा गया; और अज्ञान का अभिमान करने के कारण उसे जीव की अवस्था मैंने कहा।

That Brahman is the seat of ignorance was said in the sense of its being the ground; and because the soul identifies itself with ignorance, I called it the soul's state.

ज्ञानद्वयेन नष्टेऽस्मिन्नज्ञाने तत्कृतावृतिः
न भाति नास्ति चेत्येषा द्विविधाऽपि विनश्यति ॥ ४४ ॥

jñānadvayena naṣṭe'sminnajñāne tatkṛtāvṛtiḥ
na bhāti nāsti cetyeṣā dvividhā'pi vinaśyati || 44 ||

Jnaanadvayena nashte'sminnajnaane tatkritaavritih na bhaati naasti chetyeshaa dvividhaa'pi vinashyati

दोनों प्रकार के ज्ञान से इस अज्ञान के नष्ट होने पर उससे किया हुआ आवरण — 'न भासता है, न है' — दोनों रूपों में नष्ट हो जाता है।

When by the two kinds of knowledge that ignorance is destroyed, the covering made by it — 'it does not appear, it is not' — perishes in both its forms.

परोक्षज्ञानतो नश्येदसत्त्वावृतिहेतुता
अपरोक्षज्ञाननाश्याह्याभानावृतिहेतुता ॥ ४५ ॥

parokṣajñānato naśyedasattvāvṛtihetutā
aparokṣajñānanāśyāhyābhānāvṛtihetutā || 45 ||

Parokshajnaanato nashyedasattvaavritihetutaa aparokshajnaananaashyaahyaabhaanaavritihetutaa

परोक्ष ज्ञान से 'नहीं है' रूप आवरण का हेतु नष्ट होता है; और 'नहीं भासता' रूप आवरण का हेतु अपरोक्ष ज्ञान से ही नष्ट होता है।

By indirect knowledge the ground of the covering 'it is not' is destroyed; the ground of the covering 'it does not appear' is destroyed by direct knowledge alone.

अभानावरणे नष्टे जीवत्वारोपसंक्षयात्
कर्तृत्वाद्यखिलः शोकः संसाराख्यो निवर्तते ॥ ४६ ॥

abhānāvaraṇe naṣṭe jīvatvāropasaṃkṣayāt
kartṛtvādyakhilaḥ śokaḥ saṃsārākhyo nivartate || 46 ||

Abhaanaavarane nashte jiivatvaaropasamkshayaat kartritvaadyakhilah shokah samsaaraakhyo nivartate

'नहीं भासता' रूप आवरण के नष्ट होने पर जीवत्व का आरोप मिट जाता है; और कर्तृत्व आदि सारा शोक, जिसका नाम संसार है, निवृत्त हो जाता है।

When the covering 'it does not appear' is destroyed, the superimposition of soulhood is gone; and the whole grief of doership and the rest, named the round of the world, ceases.

निवृत्ते सर्वसंसारे नित्यमुक्तित्वभासनात्
निरंकुशा भवेत्तृप्तिः पुनः शोकासमुद्भवात् ॥ ४७ ॥

nivṛtte sarvasaṃsāre nityamuktitvabhāsanāt
niraṃkuśā bhavettṛptiḥ punaḥ śokāsamudbhavāt || 47 ||

Nivritte sarvasamsaare nityamuktitvabhaasanaat niramkushaa bhavettriptih punah shokaasamudbhavaat

सारे संसार के निवृत्त हो जाने पर, नित्य मुक्ति के भासने से, निरंकुश तृप्ति होती है, क्योंकि शोक फिर उत्पन्न नहीं होता।

When the whole round of the world has ceased, and eternal freedom shines forth, there comes unbounded contentment, for grief does not arise again.

अपरोक्षज्ञानशोकनिवृत्त्याख्ये उभे इमे
अवस्थे जीवगे ब्रूत आत्मानं चेदिति श्रुतिः ॥ ४८ ॥

aparokṣajñānaśokanivṛttyākhye ubhe ime
avasthe jīvage brūta ātmānaṃ cediti śrutiḥ || 48 ||

Aparokshajnaanashokanivrittyaakhye ubhe ime avasthe jiivage bruuta aatmaanam chediti shrutih

अपरोक्ष ज्ञान और शोक की निवृत्ति — ये दोनों जीव की अवस्थाएँ हैं; 'यदि आत्मा को जान ले' — यह श्रुति इन्हीं को कहती है।

Direct knowledge and the ceasing of grief — these two states belong to the soul; and it is of these that the scripture 'if he should know the Self' speaks.

अयमित्यपरोक्षत्वमुक्तं तद्विविधं भवेत्
विषयस्वप्रकाशत्वाद्धियाप्येवम् तदीक्षणात् ॥ ४९ ॥

ayamityaparokṣatvamuktaṃ tadvividhaṃ bhavet
viṣayasvaprakāśatvāddhiyāpyevam tadīkṣaṇāt || 49 ||

Ayamityaparokshatvamuktam tadvividham bhavet vishayasvaprakaashatvaaddhiyaapyevam tadiikshanaat

'अयम्' से अपरोक्षता कही गई; वह दो प्रकार की होती है — विषय के स्वयंप्रकाश होने से, और बुद्धि से भी उसके देखे जाने से।

By 'this' its direct presence was declared; and that is of two kinds — because the object is self-luminous, and because it is seen by the understanding as well.

परोक्षज्ञानकालेऽपि विषयस्वप्रकाशता
समा ब्रह्म स्वप्रकाशमस्तीत्येवं विबोधनात् ॥ ५० ॥

parokṣajñānakāle'pi viṣayasvaprakāśatā
samā brahma svaprakāśamastītyevaṃ vibodhanāt || 50 ||

Parokshajnaanakaale'pi vishayasvaprakaashataa samaa brahma svaprakaashamastiityevam vibodhanaat

परोक्ष ज्ञान के समय भी विषय की स्वयंप्रकाशता समान ही है, क्योंकि 'ब्रह्म स्वयंप्रकाश है' — यह भी वहाँ जाना जाता है।

Even at the time of indirect knowledge the self-luminousness of the object is the same, since there too it is known that Brahman is self-luminous.

अहं ब्रह्मेत्यनुल्लिख्य ब्रह्मास्तीत्येवमुल्लिखेत्
परोक्षज्ञानमेतन्न भ्रान्तं बाधानिरूपणात् ॥ ५१ ॥

ahaṃ brahmetyanullikhya brahmāstītyevamullikhet
parokṣajñānametanna bhrāntaṃ bādhānirūpaṇāt || 51 ||

Aham brahmetyanullikhya brahmaastiityevamullikhet parokshajnaanametanna bhraantam baadhaaniruupanaat

'मैं ब्रह्म हूँ' — ऐसा न कहकर 'ब्रह्म है' — इतना ही कहे; यह परोक्ष ज्ञान भ्रान्त नहीं है, क्योंकि इसका कोई बाध नहीं दिखाया जा सकता।

Without saying 'I am Brahman', one may say only 'Brahman is'; this indirect knowledge is not erroneous, since no setting-aside of it can be shown.

ब्रह्म नास्तीति मानं चेत् स्याद्वाध्येत तदा ध्रुवम्
न चैवं प्रबलम् मानं पश्यामोऽतो न बाध्यते ॥ ५२ ॥

brahma nāstīti mānaṃ cet syādvādhyeta tadā dhruvam
na caivaṃ prabalam mānaṃ paśyāmo'to na bādhyate || 52 ||

Brahma naastiiti maanam chet syaadvaadhyeta tadaa dhruvam na chaivam prabalam maanam pashyaamo'to na baadhyate

यदि 'ब्रह्म नहीं है' — ऐसा कोई प्रमाण हो तो वह निश्चय ही बाधित हो जाए; पर ऐसा प्रबल प्रमाण हम नहीं देखते, इसलिए वह बाधित नहीं होता।

If there were a proof that Brahman is not, it would certainly be set aside; but we see no such strong proof, and so it is not set aside.

व्यक्त्यनुल्लेखमात्रेण भ्रमत्वे स्वर्गधीरपि
भ्रान्तिः स्याद्व्यक्त्यनुल्लेखात्सामान्योल्लेखदर्शनात् ॥ ५३ ॥

vyaktyanullekhamātreṇa bhramatve svargadhīrapi
bhrāntiḥ syādvyaktyanullekhātsāmānyollekhadarśanāt || 53 ||

Vyaktyanullekhamaatrena bhramatve svargadhiirapi bhraantih syaadvyaktyanullekhaatsaamaanyollekhadarshanaat

यदि व्यक्ति के उल्लेख न होने मात्र से भ्रान्ति हो, तो स्वर्ग की बुद्धि भी भ्रान्ति हो जाएगी, क्योंकि वहाँ भी व्यक्ति का उल्लेख नहीं, केवल सामान्य का उल्लेख दिखता है।

If error followed merely from the particular not being mentioned, the notion of heaven too would be error, for there also only the general is mentioned and not the particular.

अपरोक्षत्वयोग्यस्य न परोक्षमतिर्भ्रमः
परोक्षमित्यनुल्लेखादर्थात्पारोक्ष्यसंभवात् ॥ ५४ ॥

aparokṣatvayogyasya na parokṣamatirbhramaḥ
parokṣamityanullekhādarthātpārokṣyasaṃbhavāt || 54 ||

Aparokshatvayogyasya na parokshamatirbhramah parokshamityanullekhaadarthaatpaarokshyasambhavaat

जो अपरोक्ष होने योग्य है, उसका परोक्ष ज्ञान भ्रम नहीं है; क्योंकि 'यह परोक्ष है' — ऐसा उल्लेख नहीं होता, और अर्थतः परोक्षता सम्भव है।

Of what is fit to be directly present, indirect knowledge is not error; for it is not said 'this is beyond the senses', and indirectness is possible in the sense meant.

अंशागृहीतेर्भ्रान्तिश्चेद्घटज्ञानं भ्रमो भवेत्
निरंशस्यापि सांशत्वं व्यावर्त्यांशविभेदतः ॥ ५५ ॥

aṃśāgṛhīterbhrāntiścedghaṭajñānaṃ bhramo bhavet
niraṃśasyāpi sāṃśatvaṃ vyāvartyāṃśavibhedataḥ || 55 ||

Amshaagrihiiterbhraantishchedghatajnaanam bhramo bhavet niramshasyaapi saamshatvam vyaavartyaamshavibhedatah

यदि अंश के न ग्रहण से भ्रान्ति हो तो घट का ज्ञान भी भ्रम हो जाएगा; निरंश में भी व्यावर्त्य अंशों के भेद से सांशता आ जाती है।

If error followed from not grasping a part, the knowledge of a pot would be error too; even in the partless, parts arise by the difference of what is excluded.

असत्त्वांशो निवर्तेत परोक्षज्ञानतस्तदा
अभानांशनिवृत्तिः स्यादपरोक्षधिया कृता ॥ ५६ ॥

asattvāṃśo nivarteta parokṣajñānatastadā
abhānāṃśanivṛttiḥ syādaparokṣadhiyā kṛtā || 56 ||

Asattvaamsho nivarteta parokshajnaanatastadaa abhaanaamshanivrittih syaadaparokshadhiyaa kritaa

तब परोक्ष ज्ञान से 'नहीं है' वाला अंश निवृत्त होता है; और 'नहीं भासता' वाले अंश की निवृत्ति अपरोक्ष बुद्धि से की जाती है।

Then by indirect knowledge the portion 'it is not' ceases; and the ceasing of the portion 'it does not appear' is brought about by direct knowledge.

दशमोऽस्तीत्यविभ्रान्तं परोक्षज्ञानमीक्ष्यते
ब्रह्मास्तीत्यपि तद्वत्स्यादज्ञानावरणं समम् ॥ ५७ ॥

daśamo'stītyavibhrāntaṃ parokṣajñānamīkṣyate
brahmāstītyapi tadvatsyādajñānāvaraṇaṃ samam || 57 ||

Dashamo'stiityavibhraantam parokshajnaanamiikshyate brahmaastiityapi tadvatsyaadajnaanaavaranam samam

'दसवाँ है' — यह परोक्ष ज्ञान भ्रान्ति-रहित देखा जाता है; वैसे ही 'ब्रह्म है' भी हो, और अज्ञान का आवरण भी वैसा ही समान है।

'The tenth is' — this indirect knowledge is seen to be free of error; so too is 'Brahman is', and the covering of ignorance is alike in both.

आत्मा ब्रह्मेति वाक्यार्थे निःशेषेण विचारिते
व्यक्तिरुल्लिख्यते यद्वद्दशमस्त्वमसीत्यतः ॥ ५८ ॥

ātmā brahmeti vākyārthe niḥśeṣeṇa vicārite
vyaktirullikhyate yadvaddaśamastvamasītyataḥ || 58 ||

Aatmaa brahmeti vaakyaarthe nihsheshena vichaarite vyaktirullikhyate yadvaddashamastvamasiityatah

'आत्मा ब्रह्म है' — इस वाक्य के अर्थ का पूरी तरह विचार करने पर व्यक्ति का उल्लेख वैसे ही होता है जैसे 'तू दसवाँ है' से।

When the meaning of the sentence 'the Self is Brahman' has been fully weighed, the particular is mentioned just as it is by 'thou art the tenth'.

दशमः क इति प्रश्ने त्वमेवेति निराकृते
गणयित्वा स्वेन सह स्वमेव दशमं स्मरेत् ॥ ५९ ॥

daśamaḥ ka iti praśne tvameveti nirākṛte
gaṇayitvā svena saha svameva daśamaṃ smaret || 59 ||

Dashamah ka iti prashne tvameveti niraakrite ganayitvaa svena saha svameva dashamam smaret

'दसवाँ कौन है?' — इस प्रश्न पर 'तू ही है' कहकर निराकरण होने पर, अपने सहित गिनकर वह अपने को ही दसवाँ स्मरण करता है।

To the question 'who is the tenth?' the answer 'thou art' removes the doubt; counting with himself included, he recalls that he himself is the tenth.

दशमोऽस्मीति वाक्योत्था न धीरस्य विहन्यते
आदिमध्यावसानेषु न नवत्वस्य संशयः ॥ ६० ॥

daśamo'smīti vākyotthā na dhīrasya vihanyate
ādimadhyāvasāneṣu na navatvasya saṃśayaḥ || 60 ||

Dashamo'smiiti vaakyotthaa na dhiirasya vihanyate aadimadhyaavasaaneshu na navatvasya samshayah

'मैं दसवाँ हूँ' — वाक्य से उत्पन्न यह बुद्धि नष्ट नहीं होती; आदि, मध्य और अन्त में नौ के होने का कोई सन्देह नहीं रहता।

The conviction born of the sentence 'I am the tenth' is not destroyed; at beginning, middle and end there is no doubt about the nine.

सदेवेत्यादिवाक्येन ब्रह्मसत्त्वं परोक्षतः
गृहीत्वा तत्त्वमस्यादिवाक्याद्व्यक्तिं समुल्लिखेत् ॥ ६१ ॥

sadevetyādivākyena brahmasattvaṃ parokṣataḥ
gṛhītvā tattvamasyādivākyādvyaktiṃ samullikhet || 61 ||

Sadevetyaadivaakyena brahmasattvam parokshatah grihiitvaa tattvamasyaadivaakyaadvyaktim samullikhet

'सत् ही था' आदि वाक्य से ब्रह्म की सत्ता को परोक्ष रूप से ग्रहण करके, 'तत्त्वमसि' आदि वाक्य से व्यक्ति का उल्लेख करना चाहिए।

Having grasped the being of Brahman indirectly from such texts as 'being alone was', one should mark the particular from such texts as 'that thou art'.

आदिमध्यावसानेषु स्वस्य ब्रह्मत्वधीरियम्
नैव व्यभिचरेत्तस्मादापरोक्ष्यं प्रतिष्ठितम् ॥ ६२ ॥

ādimadhyāvasāneṣu svasya brahmatvadhīriyam
naiva vyabhicarettasmādāparokṣyaṃ pratiṣṭhitam || 62 ||

Aadimadhyaavasaaneshu svasya brahmatvadhiiriyam naiva vyabhicharettasmaadaaparokshyam pratishthitam

आदि, मध्य और अन्त में अपनी ब्रह्मता की यह बुद्धि कभी व्यभिचरित नहीं होती; इसलिए अपरोक्षता प्रतिष्ठित है।

At beginning, middle and end this conviction of one's own being Brahman never fails; and so its directness stands established.

जन्मादिकारणत्वाख्यलक्षणेन भृगुः पुरा
पारोक्ष्येण गृहीत्वाथ विचाराद्व्यक्तिमैक्षत ॥ ६३ ॥

janmādikāraṇatvākhyalakṣaṇena bhṛguḥ purā
pārokṣyeṇa gṛhītvātha vicārādvyaktimaikṣata || 63 ||

Janmaadikaaranatvaakhyalakshanena bhriguh puraa paarokshyena grihiitvaatha vichaaraadvyaktimaikshata

जन्म आदि के कारण होने के लक्षण से भृगु ने पहले परोक्ष रूप से ग्रहण किया, फिर विचार से व्यक्ति को देखा।

By the mark of being the cause of birth and the rest, Bhṛgu first grasped it indirectly, and then by enquiry saw the particular.

यद्यपि त्वमसीत्यत्र वाक्यं नोचे भृगोः पिता
तथाप्यन्नं प्राणमिति विचार्यस्थलमुक्तवान् ॥ ६४ ॥

yadyapi tvamasītyatra vākyaṃ noce bhṛgoḥ pitā
tathāpyannaṃ prāṇamiti vicāryasthalamuktavān || 64 ||

Yadyapi tvamasiityatra vaakyam noche bhrigoh pitaa tathaapyannam praanamiti vichaaryasthalamuktavaan

यद्यपि यहाँ 'तू है' ऐसा वाक्य भृगु के पिता ने नहीं कहा, तथापि 'अन्न, प्राण' — इस प्रकार विचार करने का स्थल उन्होंने बताया।

Though Bhṛgu's father did not utter the sentence 'thou art', yet he pointed out the place of enquiry, saying 'food, breath' and the rest.

अन्नप्राणादिकोशेषु सुविचार्य पुनः पुनः
आनंदव्यक्तिमीक्षित्वा ब्रह्मलक्ष्माप्ययूयुजत् ॥ ६५ ॥

annaprāṇādikośeṣu suvicārya punaḥ punaḥ
ānaṃdavyaktimīkṣitvā brahmalakṣmāpyayūyujat || 65 ||

Annapraanaadikosheshu suvichaarya punah punah aanamdavyaktimiikshitvaa brahmalakshmaapyayuuyujat

अन्न, प्राण आदि कोशों में बार-बार भलीभाँति विचार करके, आनन्द की व्यक्ति को देखकर, उसने ब्रह्म के लक्षण को उससे जोड़ा।

Enquiring again and again into the sheaths of food, breath and the rest, and seeing bliss made plain, he joined the mark of Brahman to it.

सत्यम् ज्ञानमनन्तं चेत्येवं ब्रह्मस्वलक्षणम्
उक्त्वा गुहाहितत्वेन कोशेष्वेतत्प्रदर्शितम् ॥ ६६ ॥

satyam jñānamanantaṃ cetyevaṃ brahmasvalakṣaṇam
uktvā guhāhitatvena kośeṣvetatpradarśitam || 66 ||

Satyam jnaanamanantam chetyevam brahmasvalakshanam uktvaa guhaahitatvena kosheshvetatpradarshitam

'सत्य, ज्ञान, अनन्त' — इस प्रकार ब्रह्म का स्वलक्षण कहकर, 'गुहा में स्थित' कहकर उसे कोशों में दिखाया गया।

Having stated Brahman's own mark as 'truth, knowledge, the endless', and calling it 'set in the cave', scripture showed it in the sheaths.

पारोक्ष्येण विबुध्येन्द्रो य आत्मेत्यादिलक्षणात्
अपरोक्षीकर्तुमिच्छंश्चतुर्वारं गुरुं ययौ ॥ ६७ ॥

pārokṣyeṇa vibudhyendro ya ātmetyādilakṣaṇāt
aparokṣīkartumicchaṃścaturvāraṃ guruṃ yayau || 67 ||

Paarokshyena vibudhyendro ya aatmetyaadilakshanaat aparokshiikartumichchhamshchaturvaaram gurum yayau

'जो आत्मा है' इत्यादि लक्षण से इन्द्र ने परोक्ष रूप से जाना; फिर उसे अपरोक्ष करने की इच्छा से चार बार गुरु के पास गया।

By the mark 'he who is the Self' and the rest, Indra knew indirectly; then, wishing to make it direct, he went four times to his teacher.

आत्मा वा इदमित्यादौ परोक्षं ब्रह्म लक्षितम्
अध्यारोपापवादाभ्यां प्रज्ञानं ब्रह्म दर्शितम् ॥ ६८ ॥

ātmā vā idamityādau parokṣaṃ brahma lakṣitam
adhyāropāpavādābhyāṃ prajñānaṃ brahma darśitam || 68 ||

Aatmaa vaa idamityaadau paroksham brahma lakshitam adhyaaropaapavaadaabhyaam prajnaanam brahma darshitam

'यह सब आत्मा ही था' इत्यादि में ब्रह्म परोक्ष रूप से लक्षित हुआ; और अध्यारोप तथा अपवाद से 'प्रज्ञान ब्रह्म है' — यह दिखाया गया।

In 'all this was the Self' and the like, Brahman was indicated indirectly; and by superimposition and its retraction 'consciousness is Brahman' was shown.

अवान्तरेण वाक्येन परोक्षा ब्रह्मधीर्भवेत्
सर्वत्रैव महावाक्यविचारादपरोक्षधीः ॥ ६९ ॥

avāntareṇa vākyena parokṣā brahmadhīrbhavet
sarvatraiva mahāvākyavicārādaparokṣadhīḥ || 69 ||

Avaantarena vaakyena parokshaa brahmadhiirbhavet sarvatraiva mahaavaakyavichaaraadaparokshadhiih

अवान्तर वाक्य से ब्रह्म की परोक्ष बुद्धि होती है; और सर्वत्र महावाक्य के विचार से अपरोक्ष बुद्धि होती है।

By a subsidiary sentence there comes indirect knowledge of Brahman; and everywhere by weighing the great sentence there comes direct knowledge.

ब्रह्मापरोक्ष्यसिद्ध्यर्थं महावाक्यमितीरितम्
वाक्यवृत्तावतो ब्रह्मापरोक्ष्ये विमतिर्न हि ॥ ७० ॥

brahmāparokṣyasiddhyarthaṃ mahāvākyamitīritam
vākyavṛttāvato brahmāparokṣye vimatirna hi || 70 ||

Brahmaaparokshyasiddhyartham mahaavaakyamitiiritam vaakyavrittaavato brahmaaparokshye vimatirna hi

ब्रह्म की अपरोक्षता की सिद्धि के लिए ही 'महावाक्य' कहा गया है; इसलिए 'वाक्यवृत्ति' में ब्रह्म की अपरोक्षता के विषय में कोई मतभेद नहीं है।

It is for the sake of Brahman's direct presence that it is called the great sentence; so in the Vākyavṛtti there is no disagreement about Brahman's direct presence.

आलंबनतया भाति योऽस्मत्प्रत्ययशब्दयोः
अन्तःकरणसंभिन्नबोधः स त्वंपदाभिधः ॥ ७१ ॥

ālaṃbanatayā bhāti yo'smatpratyayaśabdayoḥ
antaḥkaraṇasaṃbhinnabodhaḥ sa tvaṃpadābhidhaḥ || 71 ||

Aalambanatayaa bhaati yo'smatpratyayashabdayoh antahkaranasambhinnabodhah sa tvampadaabhidhah

जो 'अस्मत्' प्रत्यय और शब्द के आलम्बन के रूप में भासता है — अन्तःकरण से मिला हुआ वह बोध 'त्वम्' पद का अर्थ है।

That which shines as the support of the notion and the word 'I' — the awareness mingled with the inner organ — is what the word 'thou' denotes.

मायोपाधिर्जगद्योनिः सर्वज्ञत्वादिलक्षणः
पारोक्ष्यशबलः सत्याद्यात्मकस्तत्पदाभिधः ॥ ७२ ॥

māyopādhirjagadyoniḥ sarvajñatvādilakṣaṇaḥ
pārokṣyaśabalaḥ satyādyātmakastatpadābhidhaḥ || 72 ||

Maayopaadhirjagadyonih sarvajnatvaadilakshanah paarokshyashabalah satyaadyaatmakastatpadaabhidhah

माया जिसकी उपाधि है, जो जगत् की योनि है, सर्वज्ञता आदि जिसका लक्षण है, जो परोक्षता से मिला हुआ और सत्य आदि स्वरूप है — वह 'तत्' पद का अर्थ है।

That whose adjunct is illusion, which is the womb of the world, whose mark is all-knowingness, which is mixed with indirectness and is of the nature of truth and the rest — that is what the word 'That' denotes.

प्रत्यक्परोक्षतैकस्य सद्वितीयत्वपूर्णता
विरुध्येते यतस्तस्माल्लक्षणा संप्रवर्तते ॥ ७३ ॥

pratyakparokṣataikasya sadvitīyatvapūrṇatā
virudhyete yatastasmāllakṣaṇā saṃpravartate || 73 ||

Pratyakparokshataikasya sadvitiiyatvapuurnataa virudhyete yatastasmaallakshanaa sampravartate

एक ही वस्तु का प्रत्यक् और परोक्ष होना, तथा सद्वितीय और पूर्ण होना — ये परस्पर विरुद्ध हैं; इसीलिए लक्षणा प्रवृत्त होती है।

For one and the same thing to be inward and beyond the senses, to have a second and to be full, are contradictory; and therefore indirect signification comes into play.

तत्त्वमस्यादिवाक्येषु लक्षणा भागलक्षणा
सोऽयमित्यादिवाक्यस्थपदयोरिव नापरा ॥ ७४ ॥

tattvamasyādivākyeṣu lakṣaṇā bhāgalakṣaṇā
so'yamityādivākyasthapadayoriva nāparā || 74 ||

Tattvamasyaadivaakyeshu lakshanaa bhaagalakshanaa so'yamityaadivaakyasthapadayoriva naaparaa

'तत्त्वमसि' आदि वाक्यों में जो लक्षणा है वह भाग-लक्षणा है — जैसे 'सोऽयम्' आदि वाक्यों के पदों में; और कोई नहीं।

The indirect signification in 'that thou art' and such sentences is that of a part of the meaning — as in the words of 'this is that man' — and no other.

संसर्गो वा विशिष्टो वा वाक्यार्थो नात्र संमतः
अखंडैकरसत्वेन वाक्यार्थो विदुषां मतः ॥ ७५ ॥

saṃsargo vā viśiṣṭo vā vākyārtho nātra saṃmataḥ
akhaṃḍaikarasatvena vākyārtho viduṣāṃ mataḥ || 75 ||

Samsargo vaa vishishto vaa vaakyaartho naatra sammatah akhamdaikarasatvena vaakyaartho vidushaam matah

संसर्ग-रूप या विशिष्ट-रूप वाक्यार्थ यहाँ सम्मत नहीं; विद्वानों के मत में वाक्यार्थ अखण्ड एकरस रूप ही है।

Neither a meaning of mere connection nor one of a qualified thing is accepted here; the wise hold the sentence's meaning to be the undivided one taste.

प्रत्यग्बोधो य आभाति सोऽद्वयानन्दलक्षणः
अद्वयानन्दरूपश्च प्रत्यग्बोधैकलक्षणः ॥ ७६ ॥

pratyagbodho ya ābhāti so'dvayānandalakṣaṇaḥ
advayānandarūpaśca pratyagbodhaikalakṣaṇaḥ || 76 ||

Pratyagbodho ya aabhaati so'dvayaanandalakshanah advayaanandaruupashcha pratyagbodhaikalakshanah

जो प्रत्यग्बोध भासता है वही अद्वय आनन्द-लक्षण है, और अद्वय आनन्दरूप ही एकमात्र प्रत्यग्बोध-लक्षण है।

The inward awareness that shines is itself marked as non-dual bliss, and non-dual bliss is marked as nothing but inward awareness.

इत्थमन्योन्यतादात्म्यप्रतिपत्तिर्यथा भवेत्
अब्रह्मत्वं त्वमर्थस्य व्यावर्तेत तथैव हि ॥ ७७ ॥

itthamanyonyatādātmyapratipattiryathā bhavet
abrahmatvaṃ tvamarthasya vyāvarteta tathaiva hi || 77 ||

Itthamanyonyataadaatmyapratipattiryathaa bhavet abrahmatvam tvamarthasya vyaavarteta tathaiva hi

इस प्रकार जब परस्पर तादात्म्य की प्रतिपत्ति हो जाए, तभी 'त्वम्' पदार्थ का अब्रह्मत्व निवृत्त होता है।

Only when their mutual identity is thus grasped does the non-Brahmanhood of what 'thou' denotes fall away.

तदर्थस्य च पारोक्ष्यम् यद्येवं किं ततः शृणु
पूर्णानंदैकरूपेण प्रत्यग्बोधोऽवतिष्ठते ॥ ७८ ॥

tadarthasya ca pārokṣyam yadyevaṃ kiṃ tataḥ śṛṇu
pūrṇānaṃdaikarūpeṇa pratyagbodho'vatiṣṭhate || 78 ||

Tadarthasya cha paarokshyam yadyevam kim tatah shrinu puurnaanamdaikaruupena pratyagbodho'vatishthate

और 'तत्' पदार्थ की परोक्षता भी। यदि ऐसा हो तो उससे क्या — सुनो: प्रत्यग्बोध पूर्ण आनन्द के एक रूप में स्थित हो जाता है।

And the indirectness of what 'That' denotes as well. If so, what follows? Listen: inward awareness stands as the one form of full bliss.

एवं सति महावाक्यात्परोक्षज्ञानमीर्यते
यैस्तेषां शास्त्रसिद्धान्तविज्ञानं शोभतेतराम् ॥ ७९ ॥

evaṃ sati mahāvākyātparokṣajñānamīryate
yaisteṣāṃ śāstrasiddhāntavijñānaṃ śobhatetarām || 79 ||

Evam sati mahaavaakyaatparokshajnaanamiiryate yaisteshaam shaastrasiddhaantavijnaanam shobhatetaraam

ऐसा होने पर जो महावाक्य से परोक्ष ज्ञान कहते हैं, उनका शास्त्र-सिद्धान्त का विज्ञान खूब ही शोभा पाता है।

This being so, the knowledge of the scripture's doctrine of those who say the great sentence gives only indirect knowledge shines indeed.

आस्तां शास्त्रस्य सिद्धान्तो युक्त्या वाक्यात्परोक्षधीः
स्वर्गादिवाक्यवन्नैवं दशमे व्यभिचारतः ॥ ८० ॥

āstāṃ śāstrasya siddhānto yuktyā vākyātparokṣadhīḥ
svargādivākyavannaivaṃ daśame vyabhicārataḥ || 80 ||

Aastaam shaastrasya siddhaanto yuktyaa vaakyaatparokshadhiih svargaadivaakyavannaivam dashame vyabhichaaratah

शास्त्र का सिद्धान्त रहने दो; युक्ति से ही देखो — वाक्य से परोक्ष बुद्धि, स्वर्ग आदि के वाक्य की तरह, यहाँ नहीं बनती, क्योंकि दसवें के दृष्टान्त में वह व्यभिचरित हो जाती है।

Let the doctrine of scripture be; by reasoning alone, indirect knowledge from a sentence, as with the sentence about heaven, does not hold here, since in the case of the tenth man it fails.

स्वतोऽपरोक्षजीवस्य ब्रह्मत्वमभिवांछतः
नश्येत्सिद्धापरोक्षत्वमिति युक्तिर्महत्यहो ॥ ८१ ॥

svato'parokṣajīvasya brahmatvamabhivāṃchataḥ
naśyetsiddhāparokṣatvamiti yuktirmahatyaho || 81 ||

Svato'parokshajiivasya brahmatvamabhivaamchhatah nashyetsiddhaaparokshatvamiti yuktirmahatyaho

जो जीव स्वतः अपरोक्ष है, उसकी ब्रह्मता चाहने पर उसकी सिद्ध अपरोक्षता नष्ट हो जाएगी — अहो, कैसी बड़ी युक्ति है!

That the already established directness of the soul, which is direct of itself, should be lost when its Brahmanhood is desired — what a mighty argument!

वृद्धिमिष्टवतो मूलमपि नष्टमितीदृशम्
लौकिकं वचनं सार्थं संपन्नं त्वत्प्रसादतः ॥ ८२ ॥

vṛddhimiṣṭavato mūlamapi naṣṭamitīdṛśam
laukikaṃ vacanaṃ sārthaṃ saṃpannaṃ tvatprasādataḥ || 82 ||

Vriddhimishtavato muulamapi nashtamitiidrisham laukikam vachanam saartham sampannam tvatprasaadatah

'वृद्धि चाहने वाले का मूल भी नष्ट हो गया' — यह लौकिक वचन तुम्हारी कृपा से सार्थक हो गया।

'He who wanted increase lost his capital too' — this worldly saying has been made good by your favour.

अन्तःकरणसंभिन्नबोधो जीवोऽपरोक्षताम्
अर्हत्युपाधिसद्भावान्न तु ब्रह्मानुपाधितः ॥ ८३ ॥

antaḥkaraṇasaṃbhinnabodho jīvo'parokṣatām
arhatyupādhisadbhāvānna tu brahmānupādhitaḥ || 83 ||

Antahkaranasambhinnabodho jiivo'parokshataam arhatyupaadhisadbhaavaanna tu brahmaanupaadhitah

अन्तःकरण से मिला हुआ बोध, अर्थात् जीव, उपाधि के होने से अपरोक्षता का अधिकारी है; ब्रह्म नहीं, क्योंकि वह निरुपाधिक है।

The awareness mingled with the inner organ, that is, the soul, is fit for directness because an adjunct is present; Brahman is not, being without adjunct.

नैवं ब्रह्मत्वबोधस्य सोपाधिविषयत्वतः
यावद्विदेहकैवल्यमुपाधेरनिवारणात् ॥ ८४ ॥

naivaṃ brahmatvabodhasya sopādhiviṣayatvataḥ
yāvadvidehakaivalyamupādheranivāraṇāt || 84 ||

Naivam brahmatvabodhasya sopaadhivishayatvatah yaavadvidehakaivalyamupaadheranivaaranaat

ऐसा नहीं; क्योंकि ब्रह्मत्व का बोध सोपाधि को ही विषय करता है, और विदेह-कैवल्य तक उपाधि का निवारण नहीं होता।

Not so; for the knowledge of Brahmanhood has for its object what bears the adjunct, and until bodiless aloneness the adjunct is not removed.

अन्तःकरणसाहित्यराहित्याभ्यां विशिष्यते
उपाधिर्जीवभावस्य ब्रह्मतायाश्च नान्यथा ॥ ८५ ॥

antaḥkaraṇasāhityarāhityābhyāṃ viśiṣyate
upādhirjīvabhāvasya brahmatāyāśca nānyathā || 85 ||

Antahkaranasaahityaraahityaabhyaam vishishyate upaadhirjiivabhaavasya brahmataayaashcha naanyathaa

अन्तःकरण के साथ होने और न होने से ही जीवभाव और ब्रह्मता की उपाधि में भेद होता है, और किसी प्रकार नहीं।

The adjunct distinguishes soulhood from Brahmanhood only by the presence or absence of the inner organ, and in no other way.

यथाविधिरुपाधिः स्यात्प्रतिषेधस्तथा न किम्
सुवर्णलोहभेदेन शृंखलात्वं न भिद्यते ॥ ८६ ॥

yathāvidhirupādhiḥ syātpratiṣedhastathā na kim
suvarṇalohabhedena śṛṃkhalātvaṃ na bhidyate || 86 ||

Yathaavidhirupaadhih syaatpratishedhastathaa na kim suvarnalohabhedena shrimkhalaatvam na bhidyate

जैसे विधि उपाधि है, वैसे प्रतिषेध क्यों नहीं? सोने और लोहे के भेद से शृंखला का शृंखलापन नहीं बदलता।

If affirmation is an adjunct, why not denial too? The chain's being a chain does not differ because it is of gold or of iron.

अतद्व्यावृत्तिरूपेण साक्षाद्विधिमुखेन च
वेदान्तानां प्रवृत्तिः स्याद्द्विधेत्याचार्यभाषणम् ॥ ८७ ॥

atadvyāvṛttirūpeṇa sākṣādvidhimukhena ca
vedāntānāṃ pravṛttiḥ syāddvidhetyācāryabhāṣaṇam || 87 ||

Atadvyaavrittiruupena saakshaadvidhimukhena cha vedaantaanaam pravrittih syaaddvidhetyaachaaryabhaashanam

'अतद् की व्यावृत्ति के रूप में और साक्षात् विधिमुख से — वेदान्तों की प्रवृत्ति दो प्रकार की है' — यह आचार्य का वचन है।

'The Upaniṣads proceed in two ways, by excluding what is not That and by direct affirmation' — so the teacher has said.

अहमर्थपरित्यागादहं ब्रह्मेति धीः कुतः
नैवमंशस्य हि त्यागो भागलक्षणयोदितः ॥ ८८ ॥

ahamarthaparityāgādahaṃ brahmeti dhīḥ kutaḥ
naivamaṃśasya hi tyāgo bhāgalakṣaṇayoditaḥ || 88 ||

Ahamarthaparityaagaadaham brahmeti dhiih kutah naivamamshasya hi tyaago bhaagalakshanayoditah

यदि 'अहम्' के अर्थ का ही त्याग कर दिया जाए तो 'मैं ब्रह्म हूँ' यह बुद्धि कहाँ से होगी? — ऐसा नहीं; भाग-लक्षणा से केवल एक अंश का त्याग कहा गया है।

If the meaning of 'I' were given up altogether, whence the knowledge 'I am Brahman'? Not so; by the signification of a part only one portion is given up.

अन्तःकरणसंत्यागादवशिष्टे चिदात्मनि
अहं ब्रह्मेति वाक्येन ब्रह्मत्वं साक्षिणीक्ष्यते ॥ ८९ ॥

antaḥkaraṇasaṃtyāgādavaśiṣṭe cidātmani
ahaṃ brahmeti vākyena brahmatvaṃ sākṣiṇīkṣyate || 89 ||

Antahkaranasamtyaagaadavashishte chidaatmani aham brahmeti vaakyena brahmatvam saakshiniikshyate

अन्तःकरण के त्याग से जो चिदात्मा शेष रहता है, उसी साक्षी में 'मैं ब्रह्म हूँ' इस वाक्य से ब्रह्मता देखी जाती है।

When the inner organ is given up, the Self of awareness remains; and in that witness Brahmanhood is seen by the sentence 'I am Brahman'.

स्वप्रकाशोऽपि साक्ष्येष धीवृत्या व्याप्यतेऽन्यवत्
फलव्याप्यत्वमेवास्य शास्त्रकृद्भिर्निवारितम् ॥ ९० ॥

svaprakāśo'pi sākṣyeṣa dhīvṛtyā vyāpyate'nyavat
phalavyāpyatvamevāsya śāstrakṛdbhirnivāritam || 90 ||

Svaprakaasho'pi saakshyesha dhiivrityaa vyaapyate'nyavat phalavyaapyatvamevaasya shaastrakridbhirnivaaritam

यह साक्षी स्वयंप्रकाश होने पर भी दूसरों की तरह बुद्धि-वृत्ति से व्याप्त होता है; शास्त्रकारों ने केवल इसके फल-व्याप्य होने का निषेध किया है।

Though this witness is self-luminous, it is pervaded by a movement of the understanding as other things are; what the authors of the treatises denied was only its being pervaded by the result.

बुद्धितत्स्थचिदाभासौ द्वावपि व्याप्नुतो घटम्
तत्राज्ञानं धिया नश्येदाभासेन घटः स्फुरेत् ॥ ९१ ॥

buddhitatsthacidābhāsau dvāvapi vyāpnuto ghaṭam
tatrājñānaṃ dhiyā naśyedābhāsena ghaṭaḥ sphuret || 91 ||

Buddhitatsthachidaabhaasau dvaavapi vyaapnuto ghatam tatraajnaanam dhiyaa nashyedaabhaasena ghatah sphuret

बुद्धि और उसमें स्थित चिदाभास — दोनों ही घड़े को व्याप्त करते हैं; वहाँ अज्ञान बुद्धि से नष्ट होता है और घड़ा आभास से स्फुरित होता है।

Both the understanding and the reflection of awareness within it pervade the pot; there ignorance is destroyed by the understanding and the pot shines by the reflection.

ब्रह्मण्यज्ञाननाशाय वृत्तिव्याप्तिरपेक्षिता
स्वयंस्फुरणरूपत्वान्नाभास उपयुज्यते ॥ ९२ ॥

brahmaṇyajñānanāśāya vṛttivyāptirapekṣitā
svayaṃsphuraṇarūpatvānnābhāsa upayujyate || 92 ||

Brahmanyajnaananaashaaya vrittivyaaptirapekshitaa svayamsphuranaruupatvaannaabhaasa upayujyate

ब्रह्म में अज्ञान के नाश के लिए वृत्ति की व्याप्ति अपेक्षित है; पर वह स्वयं स्फुरण-रूप है, इसलिए वहाँ आभास का उपयोग नहीं होता।

To destroy ignorance about Brahman the pervading by a mental movement is needed; but since it shines of itself, the reflection is of no use there.

चक्षुर्दीपावपेक्ष्येते घटादेर्दर्शने यथा
न दीपदर्शने किं तु चक्षुरेकमपेक्ष्यते ॥ ९३ ॥

cakṣurdīpāvapekṣyete ghaṭāderdarśane yathā
na dīpadarśane kiṃ tu cakṣurekamapekṣyate || 93 ||

Chakshurdiipaavapekshyete ghataaderdarshane yathaa na diipadarshane kim tu chakshurekamapekshyate

जैसे घड़े आदि के दर्शन में आँख और दीपक — दोनों अपेक्षित हैं; पर दीपक के दर्शन में केवल आँख ही अपेक्षित है।

As both eye and lamp are needed to see a pot, but to see the lamp the eye alone is needed.

स्थितोऽप्यसौ चिदाभासो ब्रह्मण्येकीभवेत्परम्
न तु ब्रह्मण्यतिशयं फलं कुर्याद्घटादिवत् ॥ ९४ ॥

sthito'pyasau cidābhāso brahmaṇyekībhavetparam
na tu brahmaṇyatiśayaṃ phalaṃ kuryādghaṭādivat || 94 ||

Sthito'pyasau chidaabhaaso brahmanyekiibhavetparam na tu brahmanyatishayam phalam kuryaadghataadivat

वह चिदाभास वहाँ स्थित होकर भी ब्रह्म में एक ही हो जाता है; वह ब्रह्म में घड़े आदि की तरह कोई अतिशय फल नहीं करता।

Though present there, that reflection of awareness becomes simply one with Brahman; it does not produce in Brahman any further result as it does in a pot.

अप्रमेयमनादि चेत्यत्र श्रुत्येदमीरितम्
मनसैवेदमाप्तव्यमिति धीव्याप्यता श्रुता ॥ ९५ ॥

aprameyamanādi cetyatra śrutyedamīritam
manasaivedamāptavyamiti dhīvyāpyatā śrutā || 95 ||

Aprameyamanaadi chetyatra shrutyedamiiritam manasaivedamaaptavyamiti dhiivyaapyataa shrutaa

'अप्रमेय और अनादि' — यहाँ श्रुति ने यही कहा; और 'मन से ही यह प्राप्त करने योग्य है' — इससे बुद्धि से उसकी व्याप्ति सुनी गई।

'Immeasurable and without beginning' — so scripture said here; and 'by the mind alone is it to be attained' declares that it is pervaded by the understanding.

आत्मानं चेद्विजानीयादयमस्मीति वाक्यतः
ब्रह्मात्मव्यक्तिमुल्लिख्य यो बोधः सोऽभिधीयते ॥ ९६ ॥

ātmānaṃ cedvijānīyādayamasmīti vākyataḥ
brahmātmavyaktimullikhya yo bodhaḥ so'bhidhīyate || 96 ||

Aatmaanam chedvijaaniiyaadayamasmiiti vaakyatah brahmaatmavyaktimullikhya yo bodhah so'bhidhiiyate

'यदि आत्मा को जान ले कि यह मैं हूँ' — इस वाक्य से ब्रह्मात्मा की व्यक्ति का उल्लेख करके जो बोध होता है, वही यहाँ कहा जाता है।

'If he should know the Self as “this am I”' — the knowledge that arises by marking the particular, the Self that is Brahman, from this sentence, is what is spoken of.

अस्तु बोधोऽपरोक्षोऽत्र महावाक्यात्तथाप्यसौ
न दृढः श्रवणादीनामाचार्यैः पुनरीरणात् ॥ ९७ ॥

astu bodho'parokṣo'tra mahāvākyāttathāpyasau
na dṛḍhaḥ śravaṇādīnāmācāryaiḥ punarīraṇāt || 97 ||

Astu bodho'paroksho'tra mahaavaakyaattathaapyasau na dridhah shravanaadiinaamaachaaryaih punariiranaat

मान लो कि यहाँ महावाक्य से अपरोक्ष बोध होता है; तथापि वह दृढ़ नहीं होता, इसीलिए आचार्यों ने श्रवण आदि को फिर से कहा है।

Grant that direct knowledge arises here from the great sentence; still it is not firm, and so the teachers have again enjoined hearing and the rest.

अहं ब्रह्मेति वाक्यार्थबोधो यावद्दृढीभवेत्
शमादिसहितस्तावदभ्यसेच्छ्रवणादिकम् ॥ ९८ ॥

ahaṃ brahmeti vākyārthabodho yāvaddṛḍhībhavet
śamādisahitastāvadabhyasecchravaṇādikam || 98 ||

Aham brahmeti vaakyaarthabodho yaavaddridhiibhavet shamaadisahitastaavadabhyasechchhravanaadikam

'मैं ब्रह्म हूँ' इस वाक्यार्थ का बोध जब तक दृढ़ न हो जाए, तब तक शम आदि के साथ श्रवण आदि का अभ्यास करे।

Until the knowledge of the meaning of 'I am Brahman' becomes firm, let one practise hearing and the rest, together with calm and the other virtues.

बाढं सन्ति ह्यदार्ढ्यस्य हेतवः श्रुत्यनेकता
असंभाव्यत्वमर्थस्य विपरीता च भावना ॥ ९९ ॥

bāḍhaṃ santi hyadārḍhyasya hetavaḥ śrutyanekatā
asaṃbhāvyatvamarthasya viparītā ca bhāvanā || 99 ||

Baadham santi hyadaardhyasya hetavah shrutyanekataa asambhaavyatvamarthasya vipariitaa cha bhaavanaa

ठीक है, दृढ़ता न होने के कारण हैं — श्रुतियों की अनेकता, अर्थ की असम्भाव्यता, और विपरीत भावना।

True, there are causes of its not being firm — the many scriptures, the seeming impossibility of the meaning, and the contrary habit of thought.

शाखाभेदात्कामभेदाच्छ्रुतम् कर्मान्यथान्यथा
एवमत्रापि माशंकीत्यतः श्रवणमाचरेत् ॥ १०० ॥

śākhābhedātkāmabhedācchrutam karmānyathānyathā
evamatrāpi māśaṃkītyataḥ śravaṇamācaret || 100 ||

Shaakhaabhedaatkaamabhedaachchhrutam karmaanyathaanyathaa evamatraapi maashamkiityatah shravanamaacharet

शाखा-भेद और काम-भेद से कर्म भिन्न-भिन्न सुना जाता है; 'यहाँ भी वैसा ही हो' — ऐसी शङ्का न हो, इसलिए श्रवण करना चाहिए।

Because of different branches and different desires, rites are heard of differently; lest it be suspected that it is so here too, one should hear.

वेदान्तानामशेषाणामादिमध्यावसानतः
ब्रह्मात्मन्येव तात्पर्यमिति धीः श्रवणं भवेत् ॥ १०१ ॥

vedāntānāmaśeṣāṇāmādimadhyāvasānataḥ
brahmātmanyeva tātparyamiti dhīḥ śravaṇaṃ bhavet || 101 ||

Vedaantaanaamasheshaanaamaadimadhyaavasaanatah brahmaatmanyeva taatparyamiti dhiih shravanam bhavet

'समस्त वेदान्तों का आदि, मध्य और अन्त से तात्पर्य ब्रह्मात्मा में ही है' — यह बुद्धि ही श्रवण है।

The conviction that all the Upaniṣads, by their beginning, middle and end, have their purport in the Self that is Brahman — that conviction is hearing.

समन्वयाध्याय एतत्सूक्तं धीस्वास्थ्यकारिभिः
तर्कैः संभावनाऽर्थस्य द्वितीयाध्याय ईरितः ॥ १०२ ॥

samanvayādhyāya etatsūktaṃ dhīsvāsthyakāribhiḥ
tarkaiḥ saṃbhāvanā'rthasya dvitīyādhyāya īritaḥ || 102 ||

Samanvayaadhyaaya etatsuuktam dhiisvaasthyakaaribhih tarkaih sambhaavanaa'rthasya dvitiiyaadhyaaya iiritah

समन्वय-अध्याय में यह भलीभाँति कहा गया है; और बुद्धि को स्वस्थ करने वाले तर्कों से अर्थ की सम्भावना दूसरे अध्याय में कही गई है।

This is well said in the chapter on harmony; and the possibility of the meaning, by arguments that steady the understanding, is stated in the second chapter.

बहुजन्मदृढाभ्यासाद्देहादिष्वात्मधीः क्षणात्
पुनः पुनरुदेत्येवं जगत्सत्यत्वधीरपि ॥ १०३ ॥

bahujanmadṛḍhābhyāsāddehādiṣvātmadhīḥ kṣaṇāt
punaḥ punarudetyevaṃ jagatsatyatvadhīrapi || 103 ||

Bahujanmadridhaabhyaasaaddehaadishvaatmadhiih kshanaat punah punarudetyevam jagatsatyatvadhiirapi

अनेक जन्मों के दृढ़ अभ्यास से देह आदि में आत्मबुद्धि क्षण भर में बार-बार उठती रहती है; वैसे ही जगत् की सत्यता की बुद्धि भी।

Through the firm habit of many births the sense of self in the body and the rest rises again and again in a moment; and so does the sense that the world is real.

विपरीतभावनेयं ऐकाग्र्यात्सानिवर्तते
तत्वोपदेशात्प्रागेव भवत्येतदुपासनात् ॥ १०४ ॥

viparītabhāvaneyaṃ aikāgryātsānivartate
tatvopadeśātprāgeva bhavatyetadupāsanāt || 104 ||

Vipariitabhaavaneyam aikaagryaatsaanivartate tatvopadeshaatpraageva bhavatyetadupaasanaat

यह विपरीत भावना एकाग्रता से निवृत्त होती है; और यह एकाग्रता उपासना से तत्त्वोपदेश से पहले ही हो जाती है।

This contrary habit of thought ceases by one-pointedness; and this one-pointedness comes about by worship even before the teaching of the truth.

उपास्तयोऽत एवाऽत्र ब्रह्मशास्त्रेऽपि चिन्तिताः
प्रागनभ्यासिनः पश्चाद्ब्रह्माभ्यासेन तद्भवेत् ॥ १०५ ॥

upāstayo'ta evā'tra brahmaśāstre'pi cintitāḥ
prāganabhyāsinaḥ paścādbrahmābhyāsena tadbhavet || 105 ||

Upaastayo'ta evaa'tra brahmashaastre'pi chintitaah praaganabhyaasinah pashchaadbrahmaabhyaasena tadbhavet

इसीलिए ब्रह्मशास्त्र में भी उपासनाओं का विचार किया गया है; जिसने पहले अभ्यास नहीं किया, उसके लिए बाद में ब्रह्म के अभ्यास से वह होता है।

That is why worship too is considered in the science of Brahman; for one who has not practised before, it comes afterwards by the practice of Brahman.

तच्चिंतनं तत्कथनमन्योन्यं तत्प्रबोधनम्
एतदेकपरत्वं च ब्रह्माभ्यासं विदुर्बुधाः ॥ १०६ ॥

tacciṃtanaṃ tatkathanamanyonyaṃ tatprabodhanam
etadekaparatvaṃ ca brahmābhyāsaṃ vidurbudhāḥ || 106 ||

Tachchimtanam tatkathanamanyonyam tatprabodhanam etadekaparatvam cha brahmaabhyaasam vidurbudhaah

उसका चिन्तन, उसका कथन, परस्पर उसका प्रबोधन, और उसी में एकनिष्ठ रहना — इसे बुद्धिमान् 'ब्रह्माभ्यास' कहते हैं।

Thinking of it, speaking of it, awakening one another to it, and being wholly given to it — this the wise call the practice of Brahman.

तमेवधीरो विज्ञाय प्रज्ञां कुर्वीत ब्राह्मणः
नानुध्यायेद्बहून् शब्दान् वाचो विग्लापनं हि तत् ॥ १०७ ॥

tamevadhīro vijñāya prajñāṃ kurvīta brāhmaṇaḥ
nānudhyāyedbahūn śabdān vāco viglāpanaṃ hi tat || 107 ||

Tamevadhiiro vijnaaya prajnaam kurviita braahmanah naanudhyaayedbahuun shabdaan vaacho viglaapanam hi tat

'धीर ब्राह्मण उसी को जानकर प्रज्ञा करे; बहुत शब्दों का अनुध्यान न करे, क्योंकि वह वाणी का थकाना ही है।'

'Let the steadfast knower, having known Him alone, make wisdom his own; let him not brood over many words, for that is but the wearying of speech.'

अनन्याश्चिन्तयन्तो मां ये जनाः पर्युपासते
तेषां नित्याभियुक्तानां योगक्षेमं वहाम्यहम् ॥ १०८ ॥

ananyāścintayanto māṃ ye janāḥ paryupāsate
teṣāṃ nityābhiyuktānāṃ yogakṣemaṃ vahāmyaham || 108 ||

Ananyaashchintayanto maam ye janaah paryupaasate teshaam nityaabhiyuktaanaam yogakshemam vahaamyaham

'जो लोग अनन्य भाव से मेरा चिन्तन करते हुए मेरी उपासना करते हैं, उन नित्ययुक्त पुरुषों का योगक्षेम मैं वहन करता हूँ।'

'Those men who, thinking of nothing else, worship me — for them, ever steadfast, I bear the getting and the keeping.'

इति श्रुतिस्मृती नित्यमात्मन्येकाग्रतां धियः
विधत्त विपरीताया भावनायाः क्षयाय हि ॥ १०९ ॥

iti śrutismṛtī nityamātmanyekāgratāṃ dhiyaḥ
vidhatta viparītāyā bhāvanāyāḥ kṣayāya hi || 109 ||

Iti shrutismritii nityamaatmanyekaagrataam dhiyah vidhatta vipariitaayaa bhaavanaayaah kshayaaya hi

इस प्रकार श्रुति और स्मृति आत्मा में बुद्धि की नित्य एकाग्रता का विधान करती हैं — विपरीत भावना के क्षय के लिए।

Thus scripture and the codes enjoin a constant one-pointedness of the understanding upon the Self, for the wearing away of the contrary habit of thought.

यद्यथा वर्तते तस्य तत्त्वं हित्वान्यथात्वधीः
विपरीता भावना स्यात्पित्रादावरिधीर्यथा ॥ ११० ॥

yadyathā vartate tasya tattvaṃ hitvānyathātvadhīḥ
viparītā bhāvanā syātpitrādāvaridhīryathā || 110 ||

Yadyathaa vartate tasya tattvam hitvaanyathaatvadhiih vipariitaa bhaavanaa syaatpitraadaavaridhiiryathaa

जो वस्तु जैसी है, उसका तत्त्व छोड़कर उसे अन्यथा मानना विपरीत भावना है — जैसे पिता आदि में शत्रु की बुद्धि।

To leave aside what a thing really is and take it as otherwise is the contrary habit of thought — as when a father is taken for an enemy.

आत्मा देहादिभिन्नोऽयं मिथ्या चेदं जगत्तयोः
देहाद्यात्मत्वसत्यत्वधीर्विपर्ययभावना ॥ १११ ॥

ātmā dehādibhinno'yaṃ mithyā cedaṃ jagattayoḥ
dehādyātmatvasatyatvadhīrviparyayabhāvanā || 111 ||

Aatmaa dehaadibhinno'yam mithyaa chedam jagattayoh dehaadyaatmatvasatyatvadhiirviparyayabhaavanaa

आत्मा देह आदि से भिन्न है, और यह जगत् मिथ्या है; इन दोनों के विषय में देह आदि में आत्मता और जगत् में सत्यता की बुद्धि विपर्यय-भावना है।

The Self is other than the body and the rest, and this world is false; regarding the two, to take the body for the Self and the world for real is the contrary habit.

तत्त्वभावनया नश्येत् साऽतो देहातिरिक्तताम्
आत्मनो भावयेत्तद्वन्मिथ्यात्वं जगतोऽनिशम् ॥ ११२ ॥

tattvabhāvanayā naśyet sā'to dehātiriktatām
ātmano bhāvayettadvanmithyātvaṃ jagato'niśam || 112 ||

Tattvabhaavanayaa nashyet saa'to dehaatiriktataam aatmano bhaavayettadvanmithyaatvam jagato'nisham

वह तत्त्व की भावना से नष्ट होती है; इसलिए आत्मा का देह से भिन्न होना और जगत् का मिथ्या होना निरन्तर भावित करना चाहिए।

It is destroyed by the habit of the truth; so one should constantly dwell on the Self's being other than the body and the world's being false.

किं मंत्रजपवन्मूर्तिध्यानवद्वाऽऽत्मभेदधीः
जगन्मिथ्यात्वधीश्वात्र व्यावर्त्या स्यादुतान्यथा ॥ ११३ ॥

kiṃ maṃtrajapavanmūrtidhyānavadvā''tmabhedadhīḥ
jaganmithyātvadhīśvātra vyāvartyā syādutānyathā || 113 ||

Kim mamtrajapavanmuurtidhyaanavadvaa''tmabhedadhiih jaganmithyaatvadhiishvaatra vyaavartyaa syaadutaanyathaa

क्या मन्त्रजप की तरह, या मूर्ति-ध्यान की तरह, आत्मा के भेद की बुद्धि और जगत् के मिथ्यात्व की बुद्धि यहाँ नियम से करनी है, या और किसी प्रकार?

Is the conviction of the Self's distinctness and of the world's falsity to be practised here by rule, as the muttering of a mantra or the meditation on an image, or in some other way?

अन्यथेति विजानीहि दृष्टार्थत्वेन भुक्तिवत्
बुभुक्षुर्जपवद्भुङ्क्ते न कश्चिन्नियमः क्वचित् ॥ ११४ ॥

anyatheti vijānīhi dṛṣṭārthatvena bhuktivat
bubhukṣurjapavadbhuṅkte na kaścinniyamaḥ kvacit || 114 ||

Anyatheti vijaaniihi drishtaarthatvena bhuktivat bubhukshurjapavadbhunkte na kashchinniyamah kvachit

'और प्रकार से' — ऐसा जानो; क्योंकि यह दृष्ट फल वाला है, भोजन की तरह। भूखा जप की तरह नहीं खाता; भोजन में कहीं कोई नियम नहीं।

Know it to be 'in another way'; for it has a visible fruit, like eating. A hungry man does not eat as one mutters a mantra; in eating there is nowhere any rule.

अश्नाति न वाश्नाति भुङ्क्ते वा स्वेच्छयाऽन्यथा
येन केन प्रकारेण क्षुधामपनिनीषति ॥ ११५ ॥

aśnāti na vāśnāti bhuṅkte vā svecchayā'nyathā
yena kena prakāreṇa kṣudhāmapaninīṣati || 115 ||

Ashnaati na vaashnaati bhunkte vaa svechchhayaa'nyathaa yena kena prakaarena kshudhaamapaniniishati

वह खाता है या नहीं खाता, या अपनी इच्छा से और ढंग से खाता है; जिस किसी प्रकार से वह भूख मिटाना चाहता है।

He eats, or does not eat, or eats otherwise as he pleases; by whatever means he wishes to put away his hunger.

नियमेन जपं कुर्यादकृतौ प्रत्यवायतः
अन्यथा करणेऽनर्थः स्वरवर्णविपर्ययात् ॥ ११६ ॥

niyamena japaṃ kuryādakṛtau pratyavāyataḥ
anyathā karaṇe'narthaḥ svaravarṇaviparyayāt || 116 ||

Niyamena japam kuryaadakritau pratyavaayatah anyathaa karane'narthah svaravarnaviparyayaat

जप नियम से करना चाहिए, क्योंकि न करने पर प्रत्यवाय होता है; और अन्यथा करने पर स्वर तथा वर्ण के उलट-फेर से अनर्थ होता है।

The muttering must be done by rule, since not doing it brings fault; and doing it otherwise brings harm through the misplacing of accent and letter.

क्षुधेव दृष्टबाधाकृद्विपरीता च भावना
ज्ञेया केनाप्युपायेन नास्त्यत्रानुष्ठितेः क्रमः ॥ ११७ ॥

kṣudheva dṛṣṭabādhākṛdviparītā ca bhāvanā
jñeyā kenāpyupāyena nāstyatrānuṣṭhiteḥ kramaḥ || 117 ||

Kshudheva drishtabaadhaakridvipariitaa cha bhaavanaa jneyaa kenaapyupaayena naastyatraanushthiteh kramah

भूख की तरह विपरीत भावना भी दृष्ट बाधा करने वाली है; उसे किसी भी उपाय से हटाना चाहिए — यहाँ अनुष्ठान का कोई क्रम नहीं।

Like hunger, the contrary habit of thought causes a visible hindrance; it must be got rid of by any means — here there is no fixed order of practice.

उपायः पूर्वमेवोक्तस्तच्चिन्ताकथनादिकः
एतदेकपरत्वेऽपि निबंधो ध्यानवन्न हि ॥ ११८ ॥

upāyaḥ pūrvamevoktastaccintākathanādikaḥ
etadekaparatve'pi nibaṃdho dhyānavanna hi || 118 ||

Upaayah puurvamevoktastachchintaakathanaadikah etadekaparatve'pi nibamdho dhyaanavanna hi

उपाय पहले ही कहा जा चुका — उसका चिन्तन, कथन आदि; और उसी में एकनिष्ठ रहने पर भी ध्यान की तरह कोई कठोर नियम नहीं है।

The means has already been told — thinking of it, speaking of it and the rest; and even in being wholly given to it there is no strict rule as there is in meditation.

मूर्तिप्रत्ययसांतत्यमन्यानन्तरितं धियः
ध्यानं तत्रातिनिबंधो मनसश्चंचलात्मनः ॥ ११९ ॥

mūrtipratyayasāṃtatyamanyānantaritaṃ dhiyaḥ
dhyānaṃ tatrātinibaṃdho manasaścaṃcalātmanaḥ || 119 ||

Muurtipratyayasaamtatyamanyaanantaritam dhiyah dhyaanam tatraatinibamdho manasashchamchalaatmanah

मूर्ति की प्रतीति का, बीच में किसी और से न टूटने वाला, बुद्धि का सातत्य ध्यान है; वहाँ चञ्चल मन के लिए बड़ा कठोर नियम होता है।

Meditation is the unbroken continuance in the understanding of the notion of an image, uninterrupted by anything else; and there the rule is very strict for a restless mind.

चंचलम् हि मनः कृष्ण प्रमाथि बलवद्दृढम्
तस्याहं निग्रहं मन्ये वायोरिव सुदुष्करम् ॥ १२० ॥

caṃcalam hi manaḥ kṛṣṇa pramāthi balavaddṛḍham
tasyāhaṃ nigrahaṃ manye vāyoriva suduṣkaram || 120 ||

Chamchalam hi manah krishna pramaathi balavaddridham tasyaaham nigraham manye vaayoriva sudushkaram

'हे कृष्ण, मन चञ्चल है, मथने वाला है, बलवान् और दृढ़ है; उसका निग्रह मैं वायु की तरह अत्यन्त कठिन मानता हूँ।'

'The mind, Kṛṣṇa, is restless, turbulent, strong and unyielding; to restrain it I think as hard as to restrain the wind.'

अप्यब्धिपानान्महतः सुमेरून्मूलनादपि
अपि वह्न्यशनात्साधो विषमश्चित्तनिग्रहः ॥ १२१ ॥

apyabdhipānānmahataḥ sumerūnmūlanādapi
api vahnyaśanātsādho viṣamaścittanigrahaḥ || 121 ||

Apyabdhipaanaanmahatah sumeruunmuulanaadapi api vahnyashanaatsaadho vishamashchittanigrahah

'हे साधो, महासागर को पी जाने से, सुमेरु को उखाड़ने से, और अग्नि खा जाने से भी चित्त का निग्रह कठिन है।'

'Harder, good friend, than drinking up the great ocean, than uprooting Meru, than swallowing fire, is the restraining of the mind.'

कथनादौ न निर्बंधः शृंखलाबद्धदेहवत्
किंत्वनन्तेतिहासाद्यैर्विनोदो नाट्यवद्धियः ॥ १२२ ॥

kathanādau na nirbaṃdhaḥ śṛṃkhalābaddhadehavat
kiṃtvanantetihāsādyairvinodo nāṭyavaddhiyaḥ || 122 ||

Kathanaadau na nirbamdhah shrimkhalaabaddhadehavat kimtvanantetihaasaadyairvinodo naatyavaddhiyah

कथन आदि में शृंखला से बँधे शरीर की तरह कोई जकड़न नहीं; बल्कि अनन्त इतिहास आदि से नाट्य की तरह बुद्धि का विनोद होता है।

In speaking of it and the rest there is no binding, as of a body in chains; rather the understanding is entertained by the endless tales and the like, as by a play.

चिदेवात्मा जगन्मिथ्येत्यत्र पर्यवसानतः
निदिध्यासनविक्षेपो नेतिहासादिभिर्भवेत् ॥ १२३ ॥

cidevātmā jaganmithyetyatra paryavasānataḥ
nididhyāsanavikṣepo netihāsādibhirbhavet || 123 ||

Chidevaatmaa jaganmithyetyatra paryavasaanatah nididhyaasanavikshepo netihaasaadibhirbhavet

'चित् ही आत्मा है, जगत् मिथ्या है' — इसी में पर्यवसान होने से इतिहास आदि से निदिध्यासन में विक्षेप नहीं होता।

Since all comes to rest in 'awareness alone is the Self, the world is false', the tales and the rest do not distract from meditation.

कृषिवाणिज्यसेवादौ काव्यतर्कादिकेषु च
विक्षिप्यते प्रवृत्त्या धीस्तैस्तत्त्वस्मृत्यसंभवात् ॥ १२४ ॥

kṛṣivāṇijyasevādau kāvyatarkādikeṣu ca
vikṣipyate pravṛttyā dhīstaistattvasmṛtyasaṃbhavāt || 124 ||

Krishivaanijyasevaadau kaavyatarkaadikeshu cha vikshipyate pravrittyaa dhiistaistattvasmrityasambhavaat

खेती, व्यापार, सेवा आदि में और काव्य, तर्क आदि में प्रवृत्ति से बुद्धि विक्षिप्त हो जाती है, क्योंकि उनसे तत्त्व की स्मृति सम्भव नहीं रहती।

By engaging in farming, trade, service and in poetry, logic and the like, the understanding is scattered, for with them the remembrance of the truth is not possible.

अनुसंदधतैवात्र भोजनादौ प्रवर्तितुम्
शक्यतेऽत्यंतविक्षेपाभावादाशु पुनः स्मृतः ॥ १२५ ॥

anusaṃdadhataivātra bhojanādau pravartitum
śakyate'tyaṃtavikṣepābhāvādāśu punaḥ smṛtaḥ || 125 ||

Anusamdadhataivaatra bhojanaadau pravartitum shakyate'tyamtavikshepaabhaavaadaashu punah smritah

यहाँ भोजन आदि में तो अनुसन्धान करते हुए ही प्रवृत्त हुआ जा सकता है, क्योंकि अत्यन्त विक्षेप नहीं होता और शीघ्र ही स्मरण लौट आता है।

In eating and the like one can engage while still keeping the thought, for there is no utter distraction and the remembrance returns at once.

तत्वविस्मृतिमात्रान्नानर्थः किं तु विपर्ययात्
विपर्येतुं न कालोऽस्ति झटिति स्मरतः क्वचित् ॥ १२६ ॥

tatvavismṛtimātrānnānarthaḥ kiṃ tu viparyayāt
viparyetuṃ na kālo'sti jhaṭiti smarataḥ kvacit || 126 ||

Tatvavismritimaatraannaanarthah kim tu viparyayaat viparyetum na kaalo'sti jhatiti smaratah kvachit

केवल तत्त्व की विस्मृति से अनर्थ नहीं होता, बल्कि विपर्यय से होता है; और जो तुरन्त स्मरण कर लेता है, उसके लिए विपर्यय का अवसर ही नहीं आता।

Harm comes not from merely forgetting the truth but from taking it contrariwise; and for one who remembers at once there is no time anywhere for the contrary to arise.

तत्त्वस्मृतेरवसरो नास्त्यन्याभ्यासशालिनः
प्रत्युताभ्यासघातित्वाद्बलात्तत्त्वमुपेक्षते ॥ १२७ ॥

tattvasmṛteravasaro nāstyanyābhyāsaśālinaḥ
pratyutābhyāsaghātitvādbalāttattvamupekṣate || 127 ||

Tattvasmriteravasaro naastyanyaabhyaasashaalinah pratyutaabhyaasaghaatitvaadbalaattattvamupekshate

जो दूसरे अभ्यासों में लगा है, उसे तत्त्व की स्मृति का अवसर ही नहीं मिलता; उल्टे, अभ्यास का घातक होने से वह बलपूर्वक तत्त्व की उपेक्षा करता है।

One busy with other practice gets no occasion for the remembrance of the truth; rather, since it would spoil his practice, he sets the truth aside by force.

तमेवैकं विजानीथ ह्यन्या वाचो विमुंचथ
इति श्रुतं तथान्यत्र वाचो विग्लापनं त्विति ॥ १२८ ॥

tamevaikaṃ vijānītha hyanyā vāco vimuṃcatha
iti śrutaṃ tathānyatra vāco viglāpanaṃ tviti || 128 ||

Tamevaikam vijaaniitha hyanyaa vaacho vimumchatha iti shrutam tathaanyatra vaacho viglaapanam tviti

'उसी एक को जानो, और दूसरी वाणियों को छोड़ दो' — ऐसा सुना गया है; और अन्यत्र 'वह वाणी का थकाना ही है' — ऐसा भी।

'Know Him alone and let go other words' — so it is heard; and elsewhere, 'that is but the wearying of speech'.

आहारादि त्यजन्नैव जीवेच्छास्त्रान्तरं त्यजन्
किं न जीवसि येनैवं करोष्यत्र दुराग्रहम् ॥ १२९ ॥

āhārādi tyajannaiva jīvecchāstrāntaraṃ tyajan
kiṃ na jīvasi yenaivaṃ karoṣyatra durāgraham || 129 ||

Aahaaraadi tyajannaiva jiivechchhaastraantaram tyajan kim na jiivasi yenaivam karoshyatra duraagraham

आहार आदि छोड़कर तो तुम जी ही नहीं सकते; दूसरे शास्त्रों को छोड़कर क्यों नहीं जीते, जिससे यहाँ ऐसा दुराग्रह करते हो?

You cannot live giving up food and the rest; why can you not live giving up other sciences, that you are so obstinate here?

जनकादेः कथं राज्यमिति चेद्दृढबोधतः
तथा तवापि चेत्तर्कं पठ यद्वा कृषिं कुरु ॥ १३० ॥

janakādeḥ kathaṃ rājyamiti ceddṛḍhabodhataḥ
tathā tavāpi cettarkaṃ paṭha yadvā kṛṣiṃ kuru || 130 ||

Janakaadeh katham raajyamiti cheddridhabodhatah tathaa tavaapi chettarkam patha yadvaa krishim kuru

यदि पूछो कि जनक आदि का राज्य कैसे चला — तो दृढ़ बोध से; यदि तुम्हारा भी वैसा हो तो तर्क पढ़ो या खेती करो।

If you ask how Janaka and the rest ruled a kingdom — by firm knowledge; if yours is like that, then read logic or till the soil.

मिथ्यात्ववासनादार्ढ्ये प्रारब्धक्षयकांक्षया
अक्लिश्यन्तः प्रवर्तन्ते स्वस्वकर्मानुसारतः ॥ १३१ ॥

mithyātvavāsanādārḍhye prārabdhakṣayakāṃkṣayā
akliśyantaḥ pravartante svasvakarmānusārataḥ || 131 ||

Mithyaatvavaasanaadaardhye praarabdhakshayakaamkshayaa aklishyantah pravartante svasvakarmaanusaaratah

मिथ्यात्व की वासना दृढ़ हो जाने पर, प्रारब्ध के क्षय की इच्छा से, वे बिना क्लेश पाए अपने-अपने कर्म के अनुसार प्रवृत्त होते हैं।

When the habit of seeing falsity is firm, wishing the deeds already begun to be spent, they act each according to his own work, without distress.

अतिप्रसंगो माशंक्यः स्वकर्मवशवर्तिनाम्
अस्तु वा केन शक्येत कर्म वारयितुं वद ॥ १३२ ॥

atiprasaṃgo māśaṃkyaḥ svakarmavaśavartinām
astu vā kena śakyeta karma vārayituṃ vada || 132 ||

Atiprasamgo maashamkyah svakarmavashavartinaam astu vaa kena shakyeta karma vaarayitum vada

अपने कर्म के वश चलने वालों में अतिप्रसङ्ग की शङ्का न करो; अथवा हो ही — बताओ, कर्म को कौन रोक सकता है?

Do not suspect excess in those who move at the bidding of their own deeds; or let it be — tell us, who can hold back deeds?

ज्ञानिनोऽज्ञानिनश्चात्र समे प्रारब्धकर्मणि
न क्लेशो ज्ञानिनो धैर्यान्मूढः क्लिश्यत्यधैर्यतः ॥ १३३ ॥

jñānino'jñāninaścātra same prārabdhakarmaṇi
na kleśo jñānino dhairyānmūḍhaḥ kliśyatyadhairyataḥ || 133 ||

Jnaanino'jnaaninashchaatra same praarabdhakarmani na klesho jnaanino dhairyaanmuudhah klishyatyadhairyatah

प्रारब्ध कर्म यहाँ ज्ञानी और अज्ञानी दोनों में समान है; धैर्य से ज्ञानी को क्लेश नहीं होता, और अधैर्य से मूढ़ क्लेश पाता है।

The deeds already begun are the same here for the knower and the ignorant; by steadiness the knower has no distress, while the dull man suffers from want of steadiness.

मार्गे गंत्रोर्द्वयोः श्रान्तौ समायामप्यदूरतः
जानन् धैर्याद्द्रुतम् गच्छेदन्यस्तिष्ठति दीनधीः ॥ १३४ ॥

mārge gaṃtrordvayoḥ śrāntau samāyāmapyadūrataḥ
jānan dhairyāddrutam gacchedanyastiṣṭhati dīnadhīḥ || 134 ||

Maarge gamtrordvayoh shraantau samaayaamapyaduuratah jaanan dhairyaaddrutam gachchhedanyastishthati diinadhiih

मार्ग में चलने वाले दोनों के थक जाने पर, दूरी समान होने पर भी, जानने वाला धैर्य से शीघ्र चल देता है; दूसरा दीनबुद्धि होकर बैठ जाता है।

When two travellers on the road are tired and the distance is the same, the one who knows goes on quickly out of steadiness; the other sits down, poor in spirit.

साक्षात्कृतात्मधीः सम्यगविपर्ययबाधितः
किमिच्छन् कस्य कामाय शरीरमनुसंज्वरेत् ॥ १३५ ॥

sākṣātkṛtātmadhīḥ samyagaviparyayabādhitaḥ
kimicchan kasya kāmāya śarīramanusaṃjvaret || 135 ||

Saakshaatkritaatmadhiih samyagaviparyayabaadhitah kimichchhan kasya kaamaaya shariiramanusamjvaret

जिसे आत्मा का साक्षात्कार हो गया, जो विपर्यय से बाधित नहीं, वह किसकी इच्छा से और किसकी कामना के लिए शरीर के पीछे तपे?

He who has realized the Self and is not hindered by the contrary — wishing what and for whose desire should he burn after the body?

जगन्मिथ्यात्वधीभावादाक्षिप्तौ काम्यकामुकौ
तयोरभावे संतापः शाम्येन्निःस्नेहदीपवत् ॥ १३६ ॥

jaganmithyātvadhībhāvādākṣiptau kāmyakāmukau
tayorabhāve saṃtāpaḥ śāmyenniḥsnehadīpavat || 136 ||

Jaganmithyaatvadhiibhaavaadaakshiptau kaamyakaamukau tayorabhaave samtaapah shaamyennihsnehadiipavat

जगत् के मिथ्यात्व की बुद्धि से काम्य वस्तु और कामी — दोनों हट जाते हैं; उनके न रहने पर सन्ताप बिना तेल के दीपक की तरह शान्त हो जाता है।

By the conviction of the world's falsity both the thing desired and the desirer are set aside; and when they are gone, the burning is stilled like a lamp without oil.

गंधर्वपत्तने किंचिन्नैन्द्रजालिकनिर्मितं
जानन् कामयते किं तु जिहासति हसन्निदम् ॥ १३७ ॥

gaṃdharvapattane kiṃcinnaindrajālikanirmitaṃ
jānan kāmayate kiṃ tu jihāsati hasannidam || 137 ||

Gamdharvapattane kimchinnaindrajaalikanirmitam jaanan kaamayate kim tu jihaasati hasannidam

गन्धर्वनगर में या इन्द्रजाल से बनी किसी वस्तु को जानने वाला उसकी कामना नहीं करता; बल्कि हँसते हुए उसे छोड़ देना चाहता है।

Knowing a thing in a city of the sky or made by a conjuror, one does not desire it; rather, laughing, one wishes to be rid of it.

आपातरमणीयेषु भोगेष्वेवं विचारवान्
नानुरज्यति किंत्वेतान् दोषदृष्ट्या जिहासति ॥ १३८ ॥

āpātaramaṇīyeṣu bhogeṣvevaṃ vicāravān
nānurajyati kiṃtvetān doṣadṛṣṭyā jihāsati || 138 ||

Aapaataramaniiyeshu bhogeshvevam vichaaravaan naanurajyati kimtvetaan doshadrishtyaa jihaasati

इसी प्रकार विचारवान् पुरुष पहली दृष्टि में रमणीय भोगों में अनुरक्त नहीं होता, बल्कि दोष-दृष्टि से उन्हें छोड़ना चाहता है।

So the man of discernment is not drawn to enjoyments that please at first sight; seeing their fault, he wishes to be rid of them.

अर्थानामार्जने क्लेशस्तथैव परिपालने
नाशे दुःखं व्यये दुःखं धिगर्थान् क्लेशकारिणः ॥ १३९ ॥

arthānāmārjane kleśastathaiva paripālane
nāśe duḥkhaṃ vyaye duḥkhaṃ dhigarthān kleśakāriṇaḥ || 139 ||

Arthaanaamaarjane kleshastathaiva paripaalane naashe duhkham vyaye duhkham dhigarthaan kleshakaarinah

धन के कमाने में क्लेश है, वैसे ही रखने में; नाश में दुःख, खर्च में दुःख — क्लेश देने वाले धन को धिक्कार है।

In getting wealth is toil, and so in keeping it; in its loss is pain and in its spending pain — fie on wealth, the bringer of toil.

मांसपांचालिकायास्तु यंत्रलोलेऽंगपंजरे
स्नाय्वस्थिग्रंथिशालिन्याः स्त्रियाः किमिव शोभनम् ॥ १४० ॥

māṃsapāṃcālikāyāstu yaṃtralole'ṃgapaṃjare
snāyvasthigraṃthiśālinyāḥ striyāḥ kimiva śobhanam || 140 ||

Maamsapaamchaalikaayaastu yamtralole'mgapamjare snaayvasthigramthishaalinyaah striyaah kimiva shobhanam

मांस की पुतली के, यन्त्र की तरह हिलते हुए अंग-पिंजर में, स्नायु, हड्डी और ग्रन्थियों से भरी स्त्री में सुन्दर क्या है?

In a doll of flesh, in a cage of limbs that moves like a machine, in a woman full of sinew, bone and knots — what is there that is beautiful?

एवमादिषु शास्त्रेषु दोषाः सम्यक् प्रपंचिताः
विमृशन्ननिशं तानि कथं दुःखेषु मज्जति ॥ १४१ ॥

evamādiṣu śāstreṣu doṣāḥ samyak prapaṃcitāḥ
vimṛśannaniśaṃ tāni kathaṃ duḥkheṣu majjati || 141 ||

Evamaadishu shaastreshu doshaah samyak prapamchitaah vimrishannanisham taani katham duhkheshu majjati

ऐसे और ऐसे शास्त्रों में दोष भलीभाँति विस्तार से कहे गए हैं; उन्हें निरन्तर विचारता हुआ पुरुष दुःखों में कैसे डूबे?

In such treatises the faults are set out at full length; how should one who weighs them constantly sink into sorrows?

क्षुधया पीड्यमानोऽपि न विषं ह्यत्तुमिच्छति
मिष्टान्नध्वस्ततृड्जानन्नमूढस्तज्जिघत्सति ॥ १४२ ॥

kṣudhayā pīḍyamāno'pi na viṣaṃ hyattumicchati
miṣṭānnadhvastatṛḍjānannamūḍhastajjighatsati || 142 ||

Kshudhayaa piidyamaano'pi na visham hyattumichchhati mishtaannadhvastatridjaanannamuudhastajjighatsati

भूख से पीड़ित होने पर भी कोई विष खाना नहीं चाहता; तो जिसकी तृष्णा मिष्ट अन्न से मिट चुकी है, वह अमूढ़ जानते हुए उसे खाना क्यों चाहेगा?

Though tormented by hunger, no one wishes to eat poison; how then should the undeluded man whose craving has been quenched by sweet food, knowing it, wish to eat it?

प्रारब्धकर्मप्राबल्याद्भोगेष्विच्छा भवेद्यदि
क्लिश्यन्नेव तदाप्येष भुङ्क्ते विष्टिगृहीतवत् ॥ १४३ ॥

prārabdhakarmaprābalyādbhogeṣvicchā bhavedyadi
kliśyanneva tadāpyeṣa bhuṅkte viṣṭigṛhītavat || 143 ||

Praarabdhakarmapraabalyaadbhogeshvichchhaa bhavedyadi klishyanneva tadaapyesha bhunkte vishtigrihiitavat

यदि प्रारब्ध कर्म की प्रबलता से भोगों में इच्छा हो जाए, तब भी वह क्लेश पाता हुआ ही भोगता है — जैसे बेगार में पकड़ा हुआ।

If through the strength of the deeds already begun a desire for enjoyments arises, even then he enjoys in distress, like one seized for forced labour.

भुंजाना वा अपि बुधाः श्रद्धावंतः कुटुंबिनः
नाद्यापि कर्म नश्छिन्नमिति क्लिश्यन्ति सम्ततं ॥ १४४ ॥

bhuṃjānā vā api budhāḥ śraddhāvaṃtaḥ kuṭuṃbinaḥ
nādyāpi karma naśchinnamiti kliśyanti samtataṃ || 144 ||

Bhumjaanaa vaa api budhaah shraddhaavamtah kutumbinah naadyaapi karma nashchhinnamiti klishyanti samtatam

भोगते हुए भी श्रद्धावान् कुटुम्बी विद्वान् 'अभी तक हमारा कर्म कटा नहीं' — ऐसा सोचकर निरन्तर क्लेश पाते हैं।

Even while enjoying, the wise who have faith and households suffer constantly, thinking, 'our deeds are not yet cut off'.

नायं क्लेशोऽत्र संसारतापः किंतु विरक्तता
भ्रान्तिज्ञाननिदानो हि तापः सांसारिकः स्मृतः ॥ १४५ ॥

nāyaṃ kleśo'tra saṃsāratāpaḥ kiṃtu viraktatā
bhrāntijñānanidāno hi tāpaḥ sāṃsārikaḥ smṛtaḥ || 145 ||

Naayam klesho'tra samsaarataapah kimtu viraktataa bhraantijnaananidaano hi taapah saamsaarikah smritah

यह क्लेश संसार का ताप नहीं है, बल्कि विरक्ति है; क्योंकि सांसारिक ताप तो भ्रान्त ज्ञान से उत्पन्न माना गया है।

This distress is not the burning of the world but dispassion; for the burning of the world is held to spring from mistaken knowledge.

विवेकेन परिक्लिश्यन्नल्पभोगेन तृप्यति
अन्यथाऽनन्तभोगेऽपि नैव तृप्यति कर्हिचित् ॥ १४६ ॥

vivekena parikliśyannalpabhogena tṛpyati
anyathā'nantabhoge'pi naiva tṛpyati karhicit || 146 ||

Vivekena pariklishyannalpabhogena tripyati anyathaa'nantabhoge'pi naiva tripyati karhichit

विवेक के साथ क्लेश पाता हुआ मनुष्य थोड़े भोग से भी तृप्त हो जाता है; अन्यथा अनन्त भोग से भी कभी तृप्त नहीं होता।

One who suffers with discernment is content with little enjoyment; otherwise he is never content even with endless enjoyment.

न जातु कामः कामानामुपभोगेन शाम्यति
हविषा कृष्णवर्त्मेव भूय एवाभिवर्धते ॥ १४७ ॥

na jātu kāmaḥ kāmānāmupabhogena śāmyati
haviṣā kṛṣṇavartmeva bhūya evābhivardhate || 147 ||

Na jaatu kaamah kaamaanaamupabhogena shaamyati havishaa krishnavartmeva bhuuya evaabhivardhate

'कामनाओं के उपभोग से काम कभी शान्त नहीं होता; घी से अग्नि की तरह वह और भी बढ़ता है।'

'Desire is never stilled by the enjoyment of what is desired; like fire fed with butter, it only grows the more.'

परिज्ञायोपभुक्तो हि भोगो भवति तुष्टये
विज्ञाय सेवितश्चोरो मैत्रीमेति न चोरताम् ॥ १४८ ॥

parijñāyopabhukto hi bhogo bhavati tuṣṭaye
vijñāya sevitaścoro maitrīmeti na coratām || 148 ||

Parijnaayopabhukto hi bhogo bhavati tushtaye vijnaaya sevitashchoro maitriimeti na chorataam

जानकर भोगा हुआ भोग ही सन्तोष देता है; चोर को पहचानकर उससे मिलना मित्रता लाता है, चोरी नहीं।

It is enjoyment taken with understanding that brings contentment; to deal with a thief knowing him is friendship, not thieving.

मनसो निगृहीतस्य लीलाभोगोऽल्पकोपि यः
तमेवालब्धविस्तारं क्लिष्टत्वाद्बहु मन्यते ॥ १४९ ॥

manaso nigṛhītasya līlābhogo'lpakopi yaḥ
tamevālabdhavistāraṃ kliṣṭatvādbahu manyate || 149 ||

Manaso nigrihiitasya liilaabhogo'lpakopi yah tamevaalabdhavistaaram klishtatvaadbahu manyate

निगृहीत मन वाले को जो थोड़ा-सा लीला-भोग भी मिलता है, उसी को वह, विस्तार न पाने और क्लेश के कारण, बहुत मानता है।

The man whose mind is restrained counts much even the small play of enjoyment that comes, since it has no spread and is mixed with distress.

बद्धमुक्तो महीपालो ग्राममात्रेण तुष्यति
परैर्नबद्धो नाऽक्रान्तो न राष्ट्रम् बहु मन्यते ॥ १५० ॥

baddhamukto mahīpālo grāmamātreṇa tuṣyati
parairnabaddho nā'krānto na rāṣṭram bahu manyate || 150 ||

Baddhamukto mahiipaalo graamamaatrena tushyati parairnabaddho naa'kraanto na raashtram bahu manyate

बन्धन से मुक्त हुआ राजा एक गाँव से ही सन्तुष्ट हो जाता है; पर जो शत्रुओं से न बँधा और न आक्रान्त हो, वह राज्य को भी बहुत नहीं मानता।

A king released from captivity is content with a single village; but one neither bound nor overrun by enemies counts even a kingdom as little.

विवेके जाग्रति सति दोषदर्शनलक्षणे
कथमारब्धकर्मापि भोगेच्छां जनयिष्यति ॥ १५१ ॥

viveke jāgrati sati doṣadarśanalakṣaṇe
kathamārabdhakarmāpi bhogecchāṃ janayiṣyati || 151 ||

Viveke jaagrati sati doshadarshanalakshane kathamaarabdhakarmaapi bhogechchhaam janayishyati

जब दोष-दर्शन रूप विवेक जाग रहा हो, तब प्रारब्ध कर्म भी भोग की इच्छा कैसे उत्पन्न करेगा?

When discernment, which is the seeing of faults, is awake, how will even the deeds already begun produce a desire for enjoyment?

नैष दोषो यतोऽनेकविधं प्रारब्धमीक्ष्यते
इच्छाऽनिच्छा परेच्छा च प्रारब्धं त्रिविधं स्मृतम् ॥ १५२ ॥

naiṣa doṣo yato'nekavidhaṃ prārabdhamīkṣyate
icchā'nicchā parecchā ca prārabdhaṃ trividhaṃ smṛtam || 152 ||

Naisha dosho yato'nekavidham praarabdhamiikshyate ichchhaa'nichchhaa parechchhaa cha praarabdham trividham smritam

यह दोष नहीं, क्योंकि प्रारब्ध अनेक प्रकार का देखा जाता है — इच्छा से, अनिच्छा से और दूसरे की इच्छा से — प्रारब्ध तीन प्रकार का माना गया है।

This is no fault, for the deeds already begun are seen to be of many kinds — by one's own wish, against one's wish, and by another's wish; three kinds are held.

अपथ्यसेविनश्चोरा राजदाररता अपि
जानन्त एव स्वानर्थमिच्छन्त्यारब्धकर्मतः ॥ १५३ ॥

apathyasevinaścorā rājadāraratā api
jānanta eva svānarthamicchantyārabdhakarmataḥ || 153 ||

Apathyasevinashchoraa raajadaararataa api jaananta eva svaanarthamichchhantyaarabdhakarmatah

अपथ्य खाने वाले, चोर, और राजा की स्त्री में आसक्त — ये अपना अनर्थ जानते हुए भी प्रारब्ध कर्म से उसे चाहते हैं।

Those who eat what harms them, thieves, and men attached to the king's women — knowing their own ruin, they still desire it, through the deeds already begun.

न चात्रैतद्वारयितुमीश्वरेणापि शक्यते
यत ईश्वर एवाऽह गीतायामर्जुनं प्रति ॥ १५४ ॥

na cātraitadvārayitumīśvareṇāpi śakyate
yata īśvara evā'ha gītāyāmarjunaṃ prati || 154 ||

Na chaatraitadvaarayitumiishvarenaapi shakyate yata iishvara evaa'ha giitaayaamarjunam prati

और यहाँ इसे रोकना ईश्वर के लिए भी सम्भव नहीं; क्योंकि ईश्वर ने ही गीता में अर्जुन से कहा है —

And here not even the Lord can prevent it; for the Lord himself said to Arjuna in the Gītā —

सदृशं चेष्टते स्वस्याः प्रकृतेर्ज्ञानवानपि
प्रकृतिं यान्ति भूतानि निग्रहः किं करिष्यति ॥ १५५ ॥

sadṛśaṃ ceṣṭate svasyāḥ prakṛterjñānavānapi
prakṛtiṃ yānti bhūtāni nigrahaḥ kiṃ kariṣyati || 155 ||

Sadrisham cheshtate svasyaah prakriterjnaanavaanapi prakritim yaanti bhuutaani nigrahah kim karishyati

'ज्ञानवान् भी अपनी प्रकृति के अनुरूप ही चेष्टा करता है; भूत प्रकृति को ही प्राप्त होते हैं — निग्रह क्या करेगा?'

'Even the man of knowledge acts according to his own nature; beings follow their nature — what will restraint do?'

अवश्यं भावि भावानां प्रतीकारो भवेद्यदि
तदा दुःखैर्नलिप्येरन्नलरामयुधिष्ठिराः ॥ १५६ ॥

avaśyaṃ bhāvi bhāvānāṃ pratīkāro bhavedyadi
tadā duḥkhairnalipyerannalarāmayudhiṣṭhirāḥ || 156 ||

Avashyam bhaavi bhaavaanaam pratiikaaro bhavedyadi tadaa duhkhairnalipyerannalaraamayudhishthiraah

यदि अवश्य होने वाले भावों का प्रतीकार सम्भव होता, तो नल, राम और युधिष्ठिर दुःखों से लिप्त न होते।

If what must happen could be warded off, then Nala, Rāma and Yudhiṣṭhira would not have been touched by sorrows.

न चेश्वरत्वमीशस्य हीयते तावता यतः
अवश्यंभाविताप्येषामीश्वरेणैव निर्मिता ॥ १५७ ॥

na ceśvaratvamīśasya hīyate tāvatā yataḥ
avaśyaṃbhāvitāpyeṣāmīśvareṇaiva nirmitā || 157 ||

Na cheshvaratvamiishasya hiiyate taavataa yatah avashyambhaavitaapyeshaamiishvarenaiva nirmitaa

इतने से ईश्वर की ईश्वरता घटती नहीं, क्योंकि इनका अवश्यम्भावी होना भी ईश्वर ने ही बनाया है।

The Lord's lordship is not lessened by this, since the inevitability of these very things was made by the Lord himself.

प्रश्नोत्तराभ्यामेवैतद्गम्यतेऽर्जुनकृष्णयोः
अनिच्छापूर्वकं चास्ति प्रारब्धमिति तच्छृणु ॥ १५८ ॥

praśnottarābhyāmevaitadgamyate'rjunakṛṣṇayoḥ
anicchāpūrvakaṃ cāsti prārabdhamiti tacchṛṇu || 158 ||

Prashnottaraabhyaamevaitadgamyate'rjunakrishnayoh anichchhaapuurvakam chaasti praarabdhamiti tachchhrinu

अर्जुन और कृष्ण के प्रश्न और उत्तर से ही यह जाना जाता है; और प्रारब्ध अनिच्छापूर्वक भी होता है — वह सुनो।

This is understood from the question and answer of Arjuna and Kṛṣṇa; and there are deeds already begun that come against one's wish — hear of that.

अथ केन प्रयुक्तोऽयं पापं चरति पूरुषः
अनिच्छन्नपि वार्ष्णेय बलादिव नियोजितः ॥ १५९ ॥

atha kena prayukto'yaṃ pāpaṃ carati pūruṣaḥ
anicchannapi vārṣṇeya balādiva niyojitaḥ || 159 ||

Atha kena prayukto'yam paapam charati puurushah anichchhannapi vaarshneya balaadiva niyojitah

'तो हे वार्ष्णेय, किससे प्रेरित होकर यह पुरुष न चाहते हुए भी, मानो बलपूर्वक जोता हुआ, पाप करता है?'

'By whom then, Vārṣṇeya, is a man driven to do wrong even against his will, as if set to it by force?'

काम एष क्रोध एष रजोगुणसमुद्भवः
महाशनो महापाप्मा विद्ध्येनमिह वैरिणम् ॥ १६० ॥

kāma eṣa krodha eṣa rajoguṇasamudbhavaḥ
mahāśano mahāpāpmā viddhyenamiha vairiṇam || 160 ||

Kaama esha krodha esha rajogunasamudbhavah mahaashano mahaapaapmaa viddhyenamiha vairinam

'यह काम है, यह क्रोध है, रजोगुण से उत्पन्न; यह महाभोजी और महापापी है — इसे यहाँ शत्रु जान।'

'It is desire, it is anger, born of the quality of energy, great in appetite and great in evil; know this to be the enemy here.'

स्वभावजेन कौंतेय निबद्धः स्वेन कर्मणा
कर्तुम् नेच्छसि यन्मोहात्करिष्यस्यवशोऽपि तत् ॥ १६१ ॥

svabhāvajena kauṃteya nibaddhaḥ svena karmaṇā
kartum necchasi yanmohātkariṣyasyavaśo'pi tat || 161 ||

Svabhaavajena kaumteya nibaddhah svena karmanaa kartum nechchhasi yanmohaatkarishyasyavasho'pi tat

'हे कौन्तेय, अपने स्वभाव से उत्पन्न अपने ही कर्म से बँधा हुआ तू, मोह से जो करना नहीं चाहता, वही विवश होकर करेगा।'

'Bound, son of Kuntī, by your own work born of your own nature, what in delusion you do not wish to do, that you will do helplessly.'

नानिच्छन्तो नचेच्छन्तो परदाक्षिण्यसंयुताः
सुखदुःखे भजन्त्येतत्परेच्छा पूर्वकर्म हि ॥ १६२ ॥

nānicchanto nacecchanto paradākṣiṇyasaṃyutāḥ
sukhaduḥkhe bhajantyetatparecchā pūrvakarma hi || 162 ||

Naanichchhanto nachechchhanto paradaakshinyasamyutaah sukhaduhkhe bhajantyetatparechchhaa puurvakarma hi

जो न चाहते हैं न नहीं चाहते, पर दूसरों के दाक्षिण्य से युक्त होते हैं, वे सुख-दुःख भोगते हैं; यही दूसरे की इच्छा से किया प्रारब्ध कर्म है।

Those who neither wish nor refuse, but act out of regard for others, meet with pleasure and pain; and that is the deed already begun through another's wish.

कथं तर्हि किमिच्छन्नित्येवमिच्छा निषिध्यते
नेच्छानिषेधः किंत्विच्छाबाधो भर्जितबीजवत् ॥ १६३ ॥

kathaṃ tarhi kimicchannityevamicchā niṣidhyate
necchāniṣedhaḥ kiṃtvicchābādho bharjitabījavat || 163 ||

Katham tarhi kimichchhannityevamichchhaa nishidhyate nechchhaanishedhah kimtvichchhaabaadho bharjitabiijavat

तो 'किसकी इच्छा से' — इस प्रकार इच्छा का निषेध कैसे किया जाता है? — यह इच्छा का निषेध नहीं, बल्कि भुने हुए बीज की तरह इच्छा का बाध है।

How then is desire denied by the words 'wishing what'? It is not the denial of desire but the setting aside of desire, like a roasted seed.

भर्जितानि तु बीजानि सन्त्यकार्यकराणि च
विद्वदिच्छा तदेष्टव्याऽसत्त्वबोधान्न कार्यकृत् ॥ १६४ ॥

bharjitāni tu bījāni santyakāryakarāṇi ca
vidvadicchā tadeṣṭavyā'sattvabodhānna kāryakṛt || 164 ||

Bharjitaani tu biijaani santyakaaryakaraani cha vidvadichchhaa tadeshtavyaa'sattvabodhaanna kaaryakrit

भुने हुए बीज होते तो हैं, पर कार्य नहीं करते; वैसे ही विद्वान् की इच्छा भी माननी चाहिए — असत्त्व के बोध से वह कार्य नहीं करती।

Roasted seeds exist but do not bear; so is the wise man's desire to be taken — knowing its unreality, it bears no fruit.

दग्धबीजमरोहेऽपि भक्षणायोपयुज्यते
विद्वदिच्छाप्यल्पभोगं कुर्यान्नव्यसनं बहु ॥ १६५ ॥

dagdhabījamarohe'pi bhakṣaṇāyopayujyate
vidvadicchāpyalpabhogaṃ kuryānnavyasanaṃ bahu || 165 ||

Dagdhabiijamarohe'pi bhakshanaayopayujyate vidvadichchhaapyalpabhogam kuryaannavyasanam bahu

जला हुआ बीज उगता नहीं, फिर भी खाने के काम आता है; वैसे ही विद्वान् की इच्छा थोड़ा भोग करा देती है, पर बहुत व्यसन नहीं।

A burnt seed does not sprout, yet serves for food; so the wise man's desire brings a little enjoyment but not great distress.

भोगेन चरितार्थत्वात्प्रारब्धं कर्म हीयते
भोक्तव्यसत्यताभ्रान्त्या व्यसनं तत्र जायते ॥ १६६ ॥

bhogena caritārthatvātprārabdhaṃ karma hīyate
bhoktavyasatyatābhrāntyā vyasanaṃ tatra jāyate || 166 ||

Bhogena charitaarthatvaatpraarabdham karma hiiyate bhoktavyasatyataabhraantyaa vyasanam tatra jaayate

भोग से चरितार्थ हो जाने पर प्रारब्ध कर्म क्षीण हो जाता है; और भोग्य की सत्यता की भ्रान्ति से ही वहाँ व्यसन उत्पन्न होता है।

Being fulfilled by enjoyment, the deed already begun wears away; and it is from the error of taking the enjoyed as real that distress arises there.

मा विनश्यत्वयं भोगो वर्धतामुत्तरोत्तरम्
मा विघ्नाः प्रतिबध्नन्तु धन्योस्म्यस्मादिति भ्रमः ॥ १६७ ॥

mā vinaśyatvayaṃ bhogo vardhatāmuttarottaram
mā vighnāḥ pratibadhnantu dhanyosmyasmāditi bhramaḥ || 167 ||

Maa vinashyatvayam bhogo vardhataamuttarottaram maa vighnaah pratibadhnantu dhanyosmyasmaaditi bhramah

'यह भोग नष्ट न हो, उत्तरोत्तर बढ़ता रहे; विघ्न इसे न रोकें; इससे मैं धन्य हूँ' — यही भ्रम है।

'Let this enjoyment not perish but grow more and more; let no obstacles hinder it; by it I am blessed' — this is the error.

यद्भावि न तद्भावि भाविचेन्न तदन्यथा
इति चिन्ताविषघ्नोऽयं बोधो भ्रमनिवर्तकः ॥ १६८ ॥

yadbhāvi na tadbhāvi bhāvicenna tadanyathā
iti cintāviṣaghno'yaṃ bodho bhramanivartakaḥ || 168 ||

Yadbhaavi na tadbhaavi bhaavichenna tadanyathaa iti chintaavishaghno'yam bodho bhramanivartakah

'जो होने वाला नहीं वह नहीं होगा, और जो होने वाला है वह अन्यथा नहीं होगा' — यह बोध चिन्ता-रूपी विष को हरने वाला और भ्रम को हटाने वाला है।

'What is not to be will not be, and what is to be will not be otherwise' — this knowledge is an antidote to the poison of anxiety and removes the error.

समेऽपि भोगे व्यसनं भ्रान्तो गच्छेन्न बुद्धवान्
अशक्यार्थस्य सम्कल्पाद्भ्रान्तस्य व्यसनम् बहु ॥ १६९ ॥

same'pi bhoge vyasanaṃ bhrānto gacchenna buddhavān
aśakyārthasya samkalpādbhrāntasya vyasanam bahu || 169 ||

Same'pi bhoge vyasanam bhraanto gachchhenna buddhavaan ashakyaarthasya samkalpaadbhraantasya vyasanam bahu

भोग समान होने पर भी भ्रान्त व्यसन को प्राप्त होता है, ज्ञानी नहीं; भ्रान्त को असम्भव वस्तु के संकल्प से बहुत व्यसन होता है।

Though the enjoyment be the same, the deluded man falls into distress and the knower does not; for the deluded, wishing the impossible, distress is great.

मायामयत्वं भोगस्य बुद्ध्वाऽस्थामुपसंहरन्
भुंजानोऽपि न संकल्पं कुरुते व्यसनं कुतः ॥ १७० ॥

māyāmayatvaṃ bhogasya buddhvā'sthāmupasaṃharan
bhuṃjāno'pi na saṃkalpaṃ kurute vyasanaṃ kutaḥ || 170 ||

Maayaamayatvam bhogasya buddhvaa'sthaamupasamharan bhumjaano'pi na samkalpam kurute vyasanam kutah

भोग के मायामय होने को जानकर, उसमें आस्था छोड़कर, भोगता हुआ भी वह संकल्प नहीं करता — फिर व्यसन कहाँ?

Knowing enjoyment to be made of illusion and withdrawing his trust from it, he forms no resolve even while enjoying — whence then distress?

स्वप्नेन्द्रजालसदृशमचिन्त्यरचनात्मकम्
दृष्टनष्टं जगत्पश्यन् कथं तत्रानुरज्यति ॥ १७१ ॥

svapnendrajālasadṛśamacintyaracanātmakam
dṛṣṭanaṣṭaṃ jagatpaśyan kathaṃ tatrānurajyati || 171 ||

Svapnendrajaalasadrishamachintyarachanaatmakam drishtanashtam jagatpashyan katham tatraanurajyati

स्वप्न और इन्द्रजाल के समान, अचिन्त्य रचना वाले, देखते ही नष्ट हो जाने वाले जगत् को देखता हुआ वह उसमें कैसे अनुरक्त हो?

Seeing the world as like a dream or a conjuring trick, of unthinkable making, gone as soon as seen — how should he be drawn to it?

स्वस्वप्नमापरोक्ष्येण दृष्ट्वा पश्यन् स्वजागरम्
चिन्तयेदप्रमत्तः सन्नुभावनुदिनं मुहुः ॥ १७२ ॥

svasvapnamāparokṣyeṇa dṛṣṭvā paśyan svajāgaram
cintayedapramattaḥ sannubhāvanudinaṃ muhuḥ || 172 ||

Svasvapnamaaparokshyena drishtvaa pashyan svajaagaram chintayedapramattah sannubhaavanudinam muhuh

अपने स्वप्न को अपरोक्ष रूप से देख चुका और अब जाग्रत् को देखता हुआ, सावधान होकर प्रतिदिन बार-बार दोनों का चिन्तन करे।

Having seen his own dream directly and now seeing his waking, let him, watchful, think on both again and again, day by day.

चिरं तयोः सर्वसाम्यमनुसंधाय जागरे
सत्यत्वबुद्धिं सन्त्यज्य नानुरज्यति पूर्ववत् ॥ १७३ ॥

ciraṃ tayoḥ sarvasāmyamanusaṃdhāya jāgare
satyatvabuddhiṃ santyajya nānurajyati pūrvavat || 173 ||

Chiram tayoh sarvasaamyamanusamdhaaya jaagare satyatvabuddhim santyajya naanurajyati puurvavat

चिरकाल तक दोनों की पूरी समानता का अनुसन्धान करके, जाग्रत् में सत्यता की बुद्धि छोड़कर वह पहले की तरह अनुरक्त नहीं होता।

Following out for long the complete likeness of the two, and giving up the sense that waking is real, he is not drawn to it as before.

इन्द्रजालमिदं द्वैतमचिन्त्यरचनात्वतः
इत्यविस्मरतो हानिः का वा प्रारब्धभोगतः ॥ १७४ ॥

indrajālamidaṃ dvaitamacintyaracanātvataḥ
ityavismarato hāniḥ kā vā prārabdhabhogataḥ || 174 ||

Indrajaalamidam dvaitamachintyarachanaatvatah ityavismarato haanih kaa vaa praarabdhabhogatah

'यह द्वैत इन्द्रजाल है, क्योंकि इसकी रचना अचिन्त्य है' — यह न भूलने वाले को प्रारब्ध के भोग से क्या हानि?

'This duality is a conjuring trick, since its making is unthinkable' — what harm comes from the enjoyment of deeds already begun to one who does not forget this?

निर्बन्धस्तत्त्वविद्याया इन्द्रजालत्वसंस्मृतौ
प्रारब्धस्याऽऽग्रहो भोगे जीवस्य सुखदुःखयोः ॥ १७५ ॥

nirbandhastattvavidyāyā indrajālatvasaṃsmṛtau
prārabdhasyā''graho bhoge jīvasya sukhaduḥkhayoḥ || 175 ||

Nirbandhastattvavidyaayaa indrajaalatvasamsmritau praarabdhasyaa''graho bhoge jiivasya sukhaduhkhayoh

तत्त्वविद्या का आग्रह इन्द्रजालपन के स्मरण में है; और प्रारब्ध का आग्रह जीव के सुख-दुःख के भोग में है।

The insistence of the knowledge of truth is on remembering that it is a conjuring trick; the insistence of the deeds already begun is on the soul's enjoyment of pleasure and pain.

विद्यारब्धे विरुध्येते न भिन्नविषयत्वतः
जानद्भिरप्यैन्द्रजालविनोदो दृश्यते ॥ १७६ ॥

vidyārabdhe virudhyete na bhinnaviṣayatvataḥ
jānadbhirapyaindrajālavinodo dṛśyate || 176 ||

Vidyaarabdhe virudhyete na bhinnavishayatvatah jaanadbhirapyaindrajaalavinodo drishyate

विद्या और प्रारब्ध विरुद्ध नहीं हैं, क्योंकि उनके विषय भिन्न हैं; जानने वालों में भी इन्द्रजाल का विनोद देखा जाता है।

Knowledge and the deeds already begun are not opposed, since their fields are different; even among those who know, delight in a conjuring show is seen.

जगत्सत्यत्वमापाद्य प्रारब्धं भोजयेद्यदि
तदा विरोधि विद्याया भोगमात्रान्न सत्यता ॥ १७७ ॥

jagatsatyatvamāpādya prārabdhaṃ bhojayedyadi
tadā virodhi vidyāyā bhogamātrānna satyatā || 177 ||

Jagatsatyatvamaapaadya praarabdham bhojayedyadi tadaa virodhi vidyaayaa bhogamaatraanna satyataa

यदि प्रारब्ध जगत् की सत्यता लाकर भोग कराए, तब वह विद्या का विरोधी होगा; केवल भोग से सत्यता नहीं आती।

If the deeds already begun brought about enjoyment by making the world real, they would oppose knowledge; but reality does not come from mere enjoyment.

अनूनो जायते भोगः कल्पितैः स्वप्नवस्तुभिः
जाग्रद्वस्तुभिरप्येवमसत्यैर्भोग इष्यताम् ॥ १७८ ॥

anūno jāyate bhogaḥ kalpitaiḥ svapnavastubhiḥ
jāgradvastubhirapyevamasatyairbhoga iṣyatām || 178 ||

Anuuno jaayate bhogah kalpitaih svapnavastubhih jaagradvastubhirapyevamasatyairbhoga ishyataam

स्वप्न की कल्पित वस्तुओं से भी भोग कम नहीं होता; वैसे ही जाग्रत् की असत्य वस्तुओं से भी भोग माना जाए।

Enjoyment is not less with the imagined things of dream; let enjoyment with the unreal things of waking be taken in the same way.

यदि विद्यापह्नुवीत जगत्प्रारब्धघातिनी
तदा स्यान्नतु मायात्वबोधेन तदपह्नवः ॥ १७९ ॥

yadi vidyāpahnuvīta jagatprārabdhaghātinī
tadā syānnatu māyātvabodhena tadapahnavaḥ || 179 ||

Yadi vidyaapahnuviita jagatpraarabdhaghaatinii tadaa syaannatu maayaatvabodhena tadapahnavah

यदि विद्या जगत् का अपह्नव करके प्रारब्ध का नाश करने वाली होती, तब (विरोध) होता; पर मायात्व के बोध से जगत् का अपह्नव नहीं होता।

If knowledge denied the world and so destroyed the deeds already begun, then there would be opposition; but knowing it to be illusion is not a denial of it.

अनपह्नुत्य लोकास्तदिन्द्रजालमिदं त्विति
जानन्त्येवानपह्नुत्य भोगं मायात्वधीस्तथा ॥ १८० ॥

anapahnutya lokāstadindrajālamidaṃ tviti
jānantyevānapahnutya bhogaṃ māyātvadhīstathā || 180 ||

Anapahnutya lokaastadindrajaalamidam tviti jaanantyevaanapahnutya bhogam maayaatvadhiistathaa

लोग 'यह इन्द्रजाल है' — ऐसा जानते हुए भी उसका अपह्नव नहीं करते; वैसे ही मायात्व की बुद्धि भोग का अपह्नव नहीं करती।

Men know 'this is a conjuring trick' and yet do not deny it; so the knowledge that it is illusion does not deny enjoyment.

यत्र त्वस्य जगत्स्वात्मा पश्येत्कस्तत्र केन किम्
किं जिघ्रेत् किं वदेद्वेति श्रुतौ तु बहु घोषितम् ॥ १८१ ॥

yatra tvasya jagatsvātmā paśyetkastatra kena kim
kiṃ jighret kiṃ vadedveti śrutau tu bahu ghoṣitam || 181 ||

Yatra tvasya jagatsvaatmaa pashyetkastatra kena kim kim jighret kim vadedveti shrutau tu bahu ghoshitam

'जहाँ इसका सारा जगत् अपना आत्मा ही हो गया, वहाँ कौन किसे देखे? किसे सूँघे, किससे बोले?' — श्रुति में बहुत घोषित है।

'Where all the world has become one's own Self, there by what should one see whom? What should one smell, what should one say?' — so scripture proclaims at length.

तेन द्वैतमपह्नुत्य विद्योदेति नान्यथा
तथा च विदुषो भोगः कथं स्यादिति चेच्छृणु ॥ १८२ ॥

tena dvaitamapahnutya vidyodeti nānyathā
tathā ca viduṣo bhogaḥ kathaṃ syāditi cecchṛṇu || 182 ||

Tena dvaitamapahnutya vidyodeti naanyathaa tathaa cha vidusho bhogah katham syaaditi chechchhrinu

इसलिए द्वैत का अपह्नव करके ही विद्या उदित होती है, और किसी प्रकार नहीं; तो विद्वान् का भोग कैसे हो — यदि यह पूछो तो सुनो।

Therefore knowledge arises only by denying duality, and not otherwise; if you ask how then the knower can enjoy, listen.

सुषुप्तिविषया मुक्तिविषया वा श्रुतिस्त्विति
उक्तं स्वाप्ययसंपत्योरिति सूत्रेऽह्यतिस्फुटम् ॥ १८३ ॥

suṣuptiviṣayā muktiviṣayā vā śrutistviti
uktaṃ svāpyayasaṃpatyoriti sūtre'hyatisphuṭam || 183 ||

Sushuptivishayaa muktivishayaa vaa shrutistviti uktam svaapyayasampatyoriti suutre'hyatisphutam

वह श्रुति सुषुप्ति के विषय में है या मुक्ति के विषय में — यह 'स्वाप्ययसंपत्योः' सूत्र में अत्यन्त स्पष्ट कहा गया है।

That scripture speaks either of deep sleep or of release — this is said most plainly in the aphorism about dissolution and attainment.

अन्यथा याज्ञवल्क्यादेराचार्यत्वं न संभवेत्
द्वैतदृष्टावविद्वत्ता द्वैतादृष्टौ न वाग्वदेत् ॥ १८४ ॥

anyathā yājñavalkyāderācāryatvaṃ na saṃbhavet
dvaitadṛṣṭāvavidvattā dvaitādṛṣṭau na vāgvadet || 184 ||

Anyathaa yaajnavalkyaaderaachaaryatvam na sambhavet dvaitadrishtaavavidvattaa dvaitaadrishtau na vaagvadet

अन्यथा याज्ञवल्क्य आदि का आचार्यपन ही सम्भव न होता; द्वैत के दिखने पर अविद्वत्ता, और द्वैत के न दिखने पर वे बोलते ही नहीं।

Otherwise the teacherhood of Yājñavalkya and the rest would be impossible; if duality were seen he would be no knower, and if it were not seen he would not speak at all.

निर्विकल्पसमाधौ तु द्वैतादर्शनहेतुतः
सैवापरोक्षविद्येति चेत् सुषुप्तिस्तथा न किम् ॥ १८५ ॥

nirvikalpasamādhau tu dvaitādarśanahetutaḥ
saivāparokṣavidyeti cet suṣuptistathā na kim || 185 ||

Nirvikalpasamaadhau tu dvaitaadarshanahetutah saivaaparokshavidyeti chet sushuptistathaa na kim

यदि कहो कि निर्विकल्प समाधि में द्वैत का न दिखना ही अपरोक्ष विद्या है — तो सुषुप्ति भी वैसी क्यों नहीं?

If you say that in distinctionless absorption the not seeing of duality is itself direct knowledge — then why is deep sleep not the same?

आत्मतत्त्वं न जानाति सुप्तौ यदि तदा त्वया
आत्मधीरेव विद्येति वाच्यं न द्वैतविस्मृतिः ॥ १८६ ॥

ātmatattvaṃ na jānāti suptau yadi tadā tvayā
ātmadhīreva vidyeti vācyaṃ na dvaitavismṛtiḥ || 186 ||

Aatmatattvam na jaanaati suptau yadi tadaa tvayaa aatmadhiireva vidyeti vaachyam na dvaitavismritih

यदि कहो कि सुषुप्ति में आत्म-तत्त्व नहीं जाना जाता — तो तुम्हें कहना पड़ेगा कि आत्मा की बुद्धि ही विद्या है, द्वैत की विस्मृति नहीं।

If you say that in deep sleep the truth of the Self is not known, then you must say that knowledge is the conviction of the Self, not the forgetting of duality.

उभयं मिलितं विद्या यदि तर्हि घटादयः
अर्धविद्याभाजिनः स्युः सकलद्वैतविस्मृतेः ॥ १८७ ॥

ubhayaṃ militaṃ vidyā yadi tarhi ghaṭādayaḥ
ardhavidyābhājinaḥ syuḥ sakaladvaitavismṛteḥ || 187 ||

Ubhayam militam vidyaa yadi tarhi ghataadayah ardhavidyaabhaajinah syuh sakaladvaitavismriteh

यदि दोनों मिलकर विद्या हो, तो घट आदि भी अर्ध-विद्या के भागी हो जाएँगे, क्योंकि उनमें समस्त द्वैत की विस्मृति है।

If knowledge were the two together, pots and the rest would share in half the knowledge, since in them all duality is forgotten.

मशकध्वनिमुख्यानां विक्षेपाणां बहुत्वतः
तव विद्या तथा न स्याद्घटादीनां यथा दृढा ॥ १८८ ॥

maśakadhvanimukhyānāṃ vikṣepāṇāṃ bahutvataḥ
tava vidyā tathā na syādghaṭādīnāṃ yathā dṛḍhā || 188 ||

Mashakadhvanimukhyaanaam vikshepaanaam bahutvatah tava vidyaa tathaa na syaadghataadiinaam yathaa dridhaa

मच्छर की ध्वनि आदि विक्षेपों की अधिकता से तुम्हारी विद्या वैसी दृढ़ न होगी जैसी घट आदि की है।

Through the many distractions, the hum of a mosquito and the rest, your knowledge will not be as firm as that of pots and the like.

आत्मधीरेव विद्येति यदि तर्हि सुखीभव
दुष्टचित्तं निरुन्ध्याश्चेन्निरुन्धि त्वं यथासुखम् ॥ १८९ ॥

ātmadhīreva vidyeti yadi tarhi sukhībhava
duṣṭacittaṃ nirundhyāścennirundhi tvaṃ yathāsukham || 189 ||

Aatmadhiireva vidyeti yadi tarhi sukhiibhava dushtachittam nirundhyaashchennirundhi tvam yathaasukham

यदि आत्मा की बुद्धि ही विद्या है, तो सुखी हो; और यदि दुष्ट चित्त का निरोध करना हो तो जैसे सुख हो वैसे निरोध करो।

If the conviction of the Self is itself knowledge, then be happy; and if you would restrain an unruly mind, restrain it as you please.

तदिष्टमेष्टव्यमायामयत्वस्य समीक्षणात्
इच्छन्नप्यज्ञवन्नेच्छेत्किमिच्छन्निति हि श्रुतम् ॥ १९० ॥

tadiṣṭameṣṭavyamāyāmayatvasya samīkṣaṇāt
icchannapyajñavannecchetkimicchanniti hi śrutam || 190 ||

Tadishtameshtavyamaayaamayatvasya samiikshanaat ichchhannapyajnavannechchhetkimichchhanniti hi shrutam

वह हमें इष्ट है; मायामयता को देखकर इच्छा करता हुआ भी वह अज्ञानी की तरह इच्छा नहीं करता — 'किसकी इच्छा से' यही तो सुना गया है।

That is what we want; seeing its illusory nature, even while desiring he does not desire as the ignorant do — for this is what 'wishing what' declares.

रागो लिंगमबोधस्य सन्तु रागादयो बुधे
इति शास्त्रद्वयं सार्थमेव सत्यविरोधतः ॥ १९१ ॥

rāgo liṃgamabodhasya santu rāgādayo budhe
iti śāstradvayaṃ sārthameva satyavirodhataḥ || 191 ||

Raago limgamabodhasya santu raagaadayo budhe iti shaastradvayam saarthameva satyavirodhatah

'राग अबोध का लिङ्ग है' और 'ज्ञानी में राग आदि रहें' — ये दोनों शास्त्र-वचन सार्थक ही हैं, क्योंकि सत्य से कोई विरोध नहीं।

'Attachment is the mark of not knowing' and 'let attachment and the rest be in the knower' — both these scriptural sayings hold good, for neither conflicts with the truth.

जगन्मिथ्यात्ववत् स्वात्मासंगत्वस्य समीक्षणात्
कस्य कामायेति वचो भोक्त्रभावविवक्षया ॥ १९२ ॥

jaganmithyātvavat svātmāsaṃgatvasya samīkṣaṇāt
kasya kāmāyeti vaco bhoktrabhāvavivakṣayā || 192 ||

Jaganmithyaatvavat svaatmaasamgatvasya samiikshanaat kasya kaamaayeti vacho bhoktrabhaavavivakshayaa

जगत् के मिथ्यात्व की तरह अपने आत्मा की असङ्गता देखने से, 'किसकी कामना के लिए' यह वचन भोक्ता के अभाव को कहना चाहता है।

As with the world's falsity, so by seeing one's own Self's unattachedness the words 'for whose desire' are meant to declare that there is no enjoyer.

पतिजायादिकं सर्वं तत्तद्भोगाय नेच्छति
किन्त्वात्मभोगार्थमिति श्रुतावुद्घोषितं बहु ॥ १९३ ॥

patijāyādikaṃ sarvaṃ tattadbhogāya necchati
kintvātmabhogārthamiti śrutāvudghoṣitaṃ bahu || 193 ||

Patijaayaadikam sarvam tattadbhogaaya nechchhati kintvaatmabhogaarthamiti shrutaavudghoshitam bahu

पति, पत्नी आदि सब कुछ उनके अपने भोग के लिए नहीं चाहा जाता, बल्कि आत्मा के भोग के लिए — यह श्रुति में बहुत घोषित है।

Husband, wife and the rest are not desired for their own sake but for the sake of the Self — this is much proclaimed in scripture.

किं कूटस्थश्चिदाभासोऽथ वा किं वोभयात्मकः
भोक्ता तत्र न कूटस्थोऽसंगत्वाद्भोक्तृतां व्रजेत् ॥ १९४ ॥

kiṃ kūṭasthaścidābhāso'tha vā kiṃ vobhayātmakaḥ
bhoktā tatra na kūṭastho'saṃgatvādbhoktṛtāṃ vrajet || 194 ||

Kim kuutasthashchidaabhaaso'tha vaa kim vobhayaatmakah bhoktaa tatra na kuutastho'samgatvaadbhoktritaam vrajet

भोक्ता कौन है — कूटस्थ, चिदाभास, या दोनों रूप वाला? वहाँ कूटस्थ नहीं, क्योंकि असङ्ग होने से वह भोक्ता नहीं बन सकता।

Who is the enjoyer — the unchanging one, the reflection, or the one made of both? Not the unchanging one, for being unattached it cannot become an enjoyer.

सुखदुःखाभिमानाख्यो विकारो भोग उच्यते
कूटस्थश्च विकारी चेत्येतन्न व्याहतं कथम् ॥ १९५ ॥

sukhaduḥkhābhimānākhyo vikāro bhoga ucyate
kūṭasthaśca vikārī cetyetanna vyāhataṃ katham || 195 ||

Sukhaduhkhaabhimaanaakhyo vikaaro bhoga uchyate kuutasthashcha vikaarii chetyetanna vyaahatam katham

सुख-दुःख के अभिमान नाम का विकार ही भोग कहलाता है; तो 'कूटस्थ' और 'विकारी' — यह कैसे विरुद्ध नहीं?

The change called the sense of pleasure and pain is what is named enjoyment; how then is 'unchanging' and 'changing' not a contradiction?

विकारिबुद्ध्यधीनत्वादाभासे विकृतावपि
निरधिष्ठानविभ्रान्तिः केवला न हि तिष्ठति ॥ १९६ ॥

vikāribuddhyadhīnatvādābhāse vikṛtāvapi
niradhiṣṭhānavibhrāntiḥ kevalā na hi tiṣṭhati || 196 ||

Vikaaribuddhyadhiinatvaadaabhaase vikritaavapi niradhishthaanavibhraantih kevalaa na hi tishthati

विकारी बुद्धि के अधीन होने से आभास में भी विकार होता है; और अधिष्ठान के बिना केवल भ्रान्ति टिकती नहीं।

Being dependent on the changing understanding, the reflection too undergoes change; and error alone, without a ground, does not stand.

उभयात्मक इत्येवाऽतो लोके भोक्ता निगद्यते
तादृगात्मानमारभ्य कूटस्थः शेषितः श्रुतौ ॥ १९७ ॥

ubhayātmaka ityevā'to loke bhoktā nigadyate
tādṛgātmānamārabhya kūṭasthaḥ śeṣitaḥ śrutau || 197 ||

Ubhayaatmaka ityevaa'to loke bhoktaa nigadyate taadrigaatmaanamaarabhya kuutasthah sheshitah shrutau

इसलिए लोक में दोनों रूप वाला ही भोक्ता कहा जाता है; वैसे आत्मा से आरम्भ करके श्रुति में कूटस्थ को शेष रखा गया है।

Therefore in the world it is the one made of both that is called the enjoyer; and starting from such a self, scripture leaves the unchanging one over.

आत्मा कतम इत्युक्ते याज्ञवल्क्यो विबोधयन्
विज्ञानमयमारभ्यासंगं तं पर्यशेषयत् ॥ १९८ ॥

ātmā katama ityukte yājñavalkyo vibodhayan
vijñānamayamārabhyāsaṃgaṃ taṃ paryaśeṣayat || 198 ||

Aatmaa katama ityukte yaajnavalkyo vibodhayan vijnaanamayamaarabhyaasamgam tam paryasheshayat

'आत्मा कौन है?' — ऐसा पूछे जाने पर याज्ञवल्क्य ने समझाते हुए विज्ञानमय से आरम्भ करके उस असङ्ग को शेष रखा।

Asked 'which is the Self?', Yājñavalkya, making it plain, began from the sheath of understanding and left over that unattached one.

कोऽयमात्मेत्येवमादौ सर्वत्राऽऽत्मविचारतः
उभयात्मकमारभ्य कूटस्थः शेष्यते श्रुतौ ॥ १९९ ॥

ko'yamātmetyevamādau sarvatrā''tmavicārataḥ
ubhayātmakamārabhya kūṭasthaḥ śeṣyate śrutau || 199 ||

Ko'yamaatmetyevamaadau sarvatraa''tmavichaaratah ubhayaatmakamaarabhya kuutasthah sheshyate shrutau

'यह आत्मा कौन है?' इत्यादि सब जगह आत्मा के विचार से, दोनों रूप वाले से आरम्भ करके श्रुति में कूटस्थ शेष रखा जाता है।

In 'who is this Self?' and everywhere else, by the enquiry into the Self, scripture begins from the one made of both and leaves the unchanging one over.

कूटस्थसत्यतां स्वस्मिन्नध्यस्यात्माविवेकतः
तात्त्विकीम् भोक्तृतां मत्वा न कदाचिज्जिहासति ॥ २०० ॥

kūṭasthasatyatāṃ svasminnadhyasyātmāvivekataḥ
tāttvikīm bhoktṛtāṃ matvā na kadācijjihāsati || 200 ||

Kuutasthasatyataam svasminnadhyasyaatmaavivekatah taattvikiim bhoktritaam matvaa na kadaachijjihaasati

अविवेक से कूटस्थ की सत्यता को अपने में आरोपित करके, भोक्तृत्व को तात्त्विक मानकर, वह उसे कभी छोड़ना नहीं चाहता।

Through want of discernment he superimposes the unchanging one's reality upon himself, and taking enjoyership for real, he never wishes to give it up.

भोक्ता स्वस्यैव भोगाय पतिजायादिमिच्छति
एष लौकिकवृत्तांतः श्रुत्या सम्यगनूदितः ॥ २०१ ॥

bhoktā svasyaiva bhogāya patijāyādimicchati
eṣa laukikavṛttāṃtaḥ śrutyā samyaganūditaḥ || 201 ||

Bhoktaa svasyaiva bhogaaya patijaayaadimichchhati esha laukikavrittaamtah shrutyaa samyaganuuditah

भोक्ता अपने ही भोग के लिए पति, पत्नी आदि चाहता है — यह लौकिक वृत्तान्त श्रुति ने भलीभाँति अनुवाद किया है।

The enjoyer desires husband, wife and the rest for his own enjoyment — this worldly fact scripture has duly restated.

भोग्यानां भोक्तृशेषत्वान्मा भोग्येष्वनुरज्यताम्
भोक्तर्येव प्रधानेऽतोऽनुरागं ते विधित्सति ॥ २०२ ॥

bhogyānāṃ bhoktṛśeṣatvānmā bhogyeṣvanurajyatām
bhoktaryeva pradhāne'to'nurāgaṃ te vidhitsati || 202 ||

Bhogyaanaam bhoktrisheshatvaanmaa bhogyeshvanurajyataam bhoktaryeva pradhaane'to'nuraagam te vidhitsati

भोग्य वस्तुएँ भोक्ता के लिए ही शेष हैं, इसलिए भोग्यों में अनुराग न हो; प्रधान भोक्ता में ही श्रुति तुम्हारा अनुराग कराना चाहती है।

Things enjoyed are only for the enjoyer, so let there be no love for them; scripture would fix your love on the enjoyer, who is chief.

या प्रीतिरविवेकानां विषयेष्वनपायिनी
त्वामनुस्मरतः सा मे हृदयान्मापसर्पतु ॥ २०३ ॥

yā prītiravivekānāṃ viṣayeṣvanapāyinī
tvāmanusmarataḥ sā me hṛdayānmāpasarpatu || 203 ||

Yaa priitiravivekaanaam vishayeshvanapaayinii tvaamanusmaratah saa me hridayaanmaapasarpatu

'अविवेकियों की जो प्रीति विषयों में कभी नहीं छूटती, वह तुम्हारा स्मरण करते हुए मेरे हृदय से न हटे।'

'The love that the undiscerning have for objects and that never leaves them — let that love, as I remember thee, never slip from my heart.'

इति न्यायेन सर्वस्माद्भोग्यजाताद्विरक्तधीः
उपसंहृत्य तां प्रीतिं भोक्तर्येवं बुभुत्सते ॥ २०४ ॥

iti nyāyena sarvasmādbhogyajātādviraktadhīḥ
upasaṃhṛtya tāṃ prītiṃ bhoktaryevaṃ bubhutsate || 204 ||

Iti nyaayena sarvasmaadbhogyajaataadviraktadhiih upasamhritya taam priitim bhoktaryevam bubhutsate

इस न्याय से समस्त भोग्य वस्तुओं से विरक्त बुद्धि वाला उस प्रीति को समेटकर भोक्ता को ही जानना चाहता है।

By this rule, one whose mind is turned from every object of enjoyment gathers that love in and wishes to know the enjoyer alone.

स्रक्चंदनवधूवस्त्रसुवर्णादिषु पामरः
अप्रमत्तो यथा तद्वन्न प्रमाद्यति भोक्तरि ॥ २०५ ॥

srakcaṃdanavadhūvastrasuvarṇādiṣu pāmaraḥ
apramatto yathā tadvanna pramādyati bhoktari || 205 ||

Srakchamdanavadhuuvastrasuvarnaadishu paamarah apramatto yathaa tadvanna pramaadyati bhoktari

जैसे साधारण मनुष्य माला, चन्दन, स्त्री, वस्त्र, सोना आदि में असावधान नहीं होता, वैसे ही वह भोक्ता के विषय में प्रमाद नहीं करता।

As the common man is not careless about garland, sandal, wife, cloth and gold, so he is not heedless about the enjoyer.

काव्यनाटकतर्कादिमभ्यस्यति निरन्तरम्
विजिगीषुर्यथा तद्वन्मुमुक्षुः स्वं विचारयेत् ॥ २०६ ॥

kāvyanāṭakatarkādimabhyasyati nirantaram
vijigīṣuryathā tadvanmumukṣuḥ svaṃ vicārayet || 206 ||

Kaavyanaatakatarkaadimabhyasyati nirantaram vijigiishuryathaa tadvanmumukshuh svam vichaarayet

जैसे जीतने की इच्छा वाला काव्य, नाटक, तर्क आदि का निरन्तर अभ्यास करता है, वैसे ही मुमुक्षु अपने आत्मा का विचार करे।

As one who wishes to win practises poetry, drama and logic without pause, so let the seeker of release enquire into his own Self.

जपयागोपासनादि कुरुते श्रद्धया यथा
स्वर्गादिवाञ्छया तद्वच्छ्रद्दध्यात्स्वे मुमुक्षया ॥ २०७ ॥

japayāgopāsanādi kurute śraddhayā yathā
svargādivāñchayā tadvacchraddadhyātsve mumukṣayā || 207 ||

Japayaagopaasanaadi kurute shraddhayaa yathaa svargaadivaanchhayaa tadvachchhraddadhyaatsve mumukshayaa

जैसे कोई स्वर्ग आदि की इच्छा से श्रद्धा के साथ जप, यज्ञ, उपासना आदि करता है, वैसे ही मुक्ति की इच्छा से अपने आत्मा में श्रद्धा रखे।

As a man with faith performs muttering, sacrifice and worship from a wish for heaven, so let him have faith in his own Self from a wish for release.

चित्तैकाग्र्यम् यथा योगी महायासेन साधयेत्
अणिमादिप्रेप्सयैवं विविच्यात् स्वं मुमुक्षया ॥ २०८ ॥

cittaikāgryam yathā yogī mahāyāsena sādhayet
aṇimādiprepsayaivaṃ vivicyāt svaṃ mumukṣayā || 208 ||

Chittaikaagryam yathaa yogii mahaayaasena saadhayet animaadiprepsayaivam vivichyaat svam mumukshayaa

जैसे अणिमा आदि की इच्छा से योगी बड़े परिश्रम से चित्त की एकाग्रता साधता है, वैसे ही मुक्ति की इच्छा से अपने आत्मा का विवेक करे।

As a yogin wins one-pointedness of mind with great labour from a wish for the powers, so let him discern his own Self from a wish for release.

कौशलानि विवर्धन्ते तेषामभ्यासपाटवात्
यथा तद्वद्विवेकोऽस्याप्यभ्यासाद्विशदायते ॥ २०९ ॥

kauśalāni vivardhante teṣāmabhyāsapāṭavāt
yathā tadvadviveko'syāpyabhyāsādviśadāyate || 209 ||

Kaushalaani vivardhante teshaamabhyaasapaatavaat yathaa tadvadviveko'syaapyabhyaasaadvishadaayate

जैसे अभ्यास की कुशलता से उनकी निपुणता बढ़ती है, वैसे ही अभ्यास से इसका विवेक भी निर्मल होता जाता है।

As their skills grow by practised training, so his discernment too grows clear by practice.

विविञ्चता भोक्तृतत्त्वं जाग्रदादिष्वसंगता
अन्वयव्यतिरेकाभ्यां साक्षिण्यध्यवसीयते ॥ २१० ॥

viviñcatā bhoktṛtattvaṃ jāgradādiṣvasaṃgatā
anvayavyatirekābhyāṃ sākṣiṇyadhyavasīyate || 210 ||

Vivinchataa bhoktritattvam jaagradaadishvasamgataa anvayavyatirekaabhyaam saakshinyadhyavasiiyate

भोक्ता के तत्त्व का विवेक करते हुए, जाग्रत् आदि अवस्थाओं में अन्वय और व्यतिरेक से साक्षी में असङ्गता निश्चित की जाती है।

While discerning the truth of the enjoyer, by presence and absence in waking and the other states, unattachedness is settled in the witness.

यत्र यद्दृश्यते द्रष्ट्रा जाग्रत्स्वप्नसुषुप्तिषु
तत्रैव तन्नेतरत्रेत्यनुभूतिर्हि सम्मता ॥ २११ ॥

yatra yaddṛśyate draṣṭrā jāgratsvapnasuṣuptiṣu
tatraiva tannetaratretyanubhūtirhi sammatā || 211 ||

Yatra yaddrishyate drashtraa jaagratsvapnasushuptishu tatraiva tannetaratretyanubhuutirhi sammataa

जाग्रत्, स्वप्न और सुषुप्ति में द्रष्टा के द्वारा जहाँ जो देखा जाता है, वह वहीं है, अन्यत्र नहीं — यह अनुभूति ही सम्मत है।

Whatever is seen by the seer in waking, dream and deep sleep is there and nowhere else — such is the experience agreed on.

स यत्तत्रेक्षते किञ्चित्तेनानन्वागतो भवेत्
दृष्ट्वैव पुण्यं पापं चेत्येवं श्रुतिषु डिंडिमः ॥ २१२ ॥

sa yattatrekṣate kiñcittenānanvāgato bhavet
dṛṣṭvaiva puṇyaṃ pāpaṃ cetyevaṃ śrutiṣu ḍiṃḍimaḥ || 212 ||

Sa yattatrekshate kinchittenaananvaagato bhavet drishtvaiva punyam paapam chetyevam shrutishu dimdimah

'वह वहाँ जो कुछ देखता है, उससे वह अनुगत नहीं होता; पुण्य और पाप को देखकर भी' — इस प्रकार श्रुतियों में डिंडिम-घोष है।

'Whatever he sees there, he is not followed by it, merit and demerit though he see them' — so the drum beats in the scriptures.

जाग्रत्स्वप्नसुषुप्त्यादिप्रपञ्चं यत्प्रकाशते
तद्ब्रह्माहमिति ज्ञात्वा सर्वबंधैः प्रमुच्यते ॥ २१३ ॥

jāgratsvapnasuṣuptyādiprapañcaṃ yatprakāśate
tadbrahmāhamiti jñātvā sarvabaṃdhaiḥ pramucyate || 213 ||

Jaagratsvapnasushuptyaadiprapancham yatprakaashate tadbrahmaahamiti jnaatvaa sarvabamdhaih pramuchyate

'जाग्रत्, स्वप्न, सुषुप्ति आदि का प्रपञ्च जिससे प्रकाशित होता है, वह ब्रह्म मैं हूँ' — ऐसा जानकर मनुष्य सब बन्धनों से मुक्त हो जाता है।

'That by which the spread of waking, dream and deep sleep is lit, that Brahman am I' — knowing this, a man is freed from every bond.

एक एवात्मा मन्तव्यो जाग्रत्स्वप्नसुषुप्तिषु
स्थानत्रयव्यतीतस्य पुनर्जन्म न विद्यते ॥ २१४ ॥

eka evātmā mantavyo jāgratsvapnasuṣuptiṣu
sthānatrayavyatītasya punarjanma na vidyate || 214 ||

Eka evaatmaa mantavyo jaagratsvapnasushuptishu sthaanatrayavyatiitasya punarjanma na vidyate

जाग्रत्, स्वप्न और सुषुप्ति में एक ही आत्मा मानना चाहिए; जो तीनों स्थानों से परे हो गया, उसका फिर जन्म नहीं होता।

One Self alone is to be held in waking, dream and deep sleep; for one who has passed beyond the three states there is no rebirth.

त्रिषु धामसु यद्भोग्यं भोक्ता भोगश्च यद्भवेत्
तेभ्यो विलक्षणः साक्षी चिन्मात्रोऽहं सदाशिवः ॥ २१५ ॥

triṣu dhāmasu yadbhogyaṃ bhoktā bhogaśca yadbhavet
tebhyo vilakṣaṇaḥ sākṣī cinmātro'haṃ sadāśivaḥ || 215 ||

Trishu dhaamasu yadbhogyam bhoktaa bhogashcha yadbhavet tebhyo vilakshanah saakshii chinmaatro'ham sadaashivah

तीनों धामों में जो भोग्य है, जो भोक्ता है और जो भोग है — उन सबसे विलक्षण साक्षी, चिन्मात्र, सदा शिव मैं हूँ।

What is enjoyed in the three abodes, and what is the enjoyer and the enjoying — other than all these am I, the witness, pure awareness, ever auspicious.

एवं विवेचिते तत्त्वे विज्ञानमयशब्दतः
चिदाभासो विकारी यो भोक्तृत्वं तस्य शिष्यते ॥ २१६ ॥

evaṃ vivecite tattve vijñānamayaśabdataḥ
cidābhāso vikārī yo bhoktṛtvaṃ tasya śiṣyate || 216 ||

Evam vivechite tattve vijnaanamayashabdatah chidaabhaaso vikaarii yo bhoktritvam tasya shishyate

इस प्रकार तत्त्व का विवेचन हो जाने पर, 'विज्ञानमय' शब्द से कहा जाने वाला जो विकारी चिदाभास है, भोक्तृत्व उसी का शेष रहता है।

The truth being thus sifted out, enjoyership is left to the changing reflection of awareness, which the word 'sheath of understanding' names.

मायिकोऽयं चिदाभासः श्रुतेरनुभवादपि
इन्द्रजालं जगत्प्रोक्तं तदन्तःपात्ययं यतः ॥ २१७ ॥

māyiko'yaṃ cidābhāsaḥ śruteranubhavādapi
indrajālaṃ jagatproktaṃ tadantaḥpātyayaṃ yataḥ || 217 ||

Maayiko'yam chidaabhaasah shruteranubhavaadapi indrajaalam jagatproktam tadantahpaatyayam yatah

यह चिदाभास मायिक है — श्रुति से भी और अनुभव से भी; क्योंकि जगत् को इन्द्रजाल कहा गया है और यह उसी के भीतर आता है।

This reflection of awareness belongs to illusion, by scripture and by experience alike; for the world is called a conjuring trick, and this falls within it.

विलयोऽप्यस्य सुप्तादौ साक्षिणाह्यनुभूयते
एतादृशं स्वस्वभावं विविनक्ति पुनः पुनः ॥ २१८ ॥

vilayo'pyasya suptādau sākṣiṇāhyanubhūyate
etādṛśaṃ svasvabhāvaṃ vivinakti punaḥ punaḥ || 218 ||

Vilayo'pyasya suptaadau saakshinaahyanubhuuyate etaadrisham svasvabhaavam vivinakti punah punah

सुषुप्ति आदि में इसका विलय भी साक्षी के द्वारा अनुभूत होता है; ऐसे अपने स्वभाव का वह बार-बार विवेचन करता है।

Its dissolution in deep sleep and the rest is experienced by the witness; such is its own nature, and he sifts it out again and again.

विविच्य नाशं निश्चित्य पुनर्भोगं न वाञ्छति
मुमूर्षुः शायितो भूमौ विवाहं कोऽभिवाञ्छति ॥ २१९ ॥

vivicya nāśaṃ niścitya punarbhogaṃ na vāñchati
mumūrṣuḥ śāyito bhūmau vivāhaṃ ko'bhivāñchati || 219 ||

Vivichya naasham nishchitya punarbhogam na vaanchhati mumuurshuh shaayito bhuumau vivaaham ko'bhivaanchhati

विवेक करके और उसके नाश का निश्चय करके वह फिर भोग नहीं चाहता; मरने को पृथ्वी पर लिटाया हुआ कौन विवाह की इच्छा करता है?

Having discerned it and settled that it perishes, he no longer wishes for enjoyment; who, laid on the ground to die, wishes for a wedding?

जिह्रेति व्यवहर्तुं च भोक्ताऽहमिति पूर्ववत्
छिन्ननास इव ह्रीतः क्लिश्यन्नारब्धमश्नुते ॥ २२० ॥

jihreti vyavahartuṃ ca bhoktā'hamiti pūrvavat
chinnanāsa iva hrītaḥ kliśyannārabdhamaśnute || 220 ||

Jihreti vyavahartum cha bhoktaa'hamiti puurvavat chhinnanaasa iva hriitah klishyannaarabdhamashnute

वह पहले की तरह 'मैं भोक्ता हूँ' — ऐसा व्यवहार करने में लज्जित होता है; नाक कटे हुए की तरह लज्जित होकर, क्लेश सहता हुआ प्रारब्ध को भोगता है।

He is ashamed to deal with things as before, saying 'I am the enjoyer'; ashamed like a man whose nose is cut off, he undergoes in distress what has already begun.

यदा स्वस्यापि भोक्तृत्वं मन्तुं जिह्रेत्ययं तदा
साक्षिण्यारोपयेदेतदिति कैव कथा वृथा ॥ २२१ ॥

yadā svasyāpi bhoktṛtvaṃ mantuṃ jihretyayaṃ tadā
sākṣiṇyāropayedetaditi kaiva kathā vṛthā || 221 ||

Yadaa svasyaapi bhoktritvam mantum jihretyayam tadaa saakshinyaaropayedetaditi kaiva kathaa vrithaa

जब वह अपने भी भोक्तृत्व को मानने में लज्जित होता है, तब इसे साक्षी पर आरोपित करने की तो व्यर्थ बात ही क्या?

When he is ashamed to own even his own enjoyership, what idle talk is there of laying it upon the witness?

इत्यभिप्रेत्य भोक्तारमाक्षिपत्यविशंकया
कस्य कामायेति ततः शरीरानुज्वरो न हि ॥ २२२ ॥

ityabhipretya bhoktāramākṣipatyaviśaṃkayā
kasya kāmāyeti tataḥ śarīrānujvaro na hi || 222 ||

Ityabhipretya bhoktaaramaakshipatyavishamkayaa kasya kaamaayeti tatah shariiraanujvaro na hi

यही अभिप्राय रखकर श्रुति निःशङ्क होकर भोक्ता का आक्षेप करती है — 'किसकी कामना के लिए'; इसलिए शरीर के पीछे तपना होता ही नहीं।

With this in view scripture boldly sets the enjoyer aside with 'for whose desire'; and so there is no burning after the body at all.

स्थूलं सूक्ष्मं कारणं च शरीरं त्रिविधं स्मृतम्
अवश्यं त्रिविधोऽस्त्येव तत्र तत्रोचितो ज्वरः ॥ २२३ ॥

sthūlaṃ sūkṣmaṃ kāraṇaṃ ca śarīraṃ trividhaṃ smṛtam
avaśyaṃ trividho'styeva tatra tatrocito jvaraḥ || 223 ||

Sthuulam suukshmam kaaranam cha shariiram trividham smritam avashyam trividho'styeva tatra tatrochito jvarah

स्थूल, सूक्ष्म और कारण — शरीर तीन प्रकार का माना गया है; और अवश्य ही तीनों में अपने-अपने योग्य ज्वर हैं।

The body is held to be of three kinds, gross, subtle and causal; and in each there is of necessity its own fitting fever.

वातपित्तश्लेष्मजन्यव्याधयः कोटिशस्तनौ
दुर्गन्धित्वकुरूपत्वदाहभङ्गादयस्तथा ॥ २२४ ॥

vātapittaśleṣmajanyavyādhayaḥ koṭiśastanau
durgandhitvakurūpatvadāhabhaṅgādayastathā || 224 ||

Vaatapittashleshmajanyavyaadhayah kotishastanau durgandhitvakuruupatvadaahabhangaadayastathaa

वात, पित्त और कफ से उत्पन्न करोड़ों व्याधियाँ शरीर में हैं; वैसे ही दुर्गन्ध, कुरूपता, जलना, टूटना आदि भी।

Diseases by the crore, born of wind, bile and phlegm, are in the body; and so are foul smell, ugliness, burning, breaking and the rest.

कामक्रोधाद्याः शान्तिदान्त्याद्या लिङ्गदेहगाः
ज्वरा द्वयेऽपि बाधन्ते प्राप्त्याप्राप्त्या नरं क्रमात् ॥ २२५ ॥

kāmakrodhādyāḥ śāntidāntyādyā liṅgadehagāḥ
jvarā dvaye'pi bādhante prāptyāprāptyā naraṃ kramāt || 225 ||

Kaamakrodhaadyaah shaantidaantyaadyaa lingadehagaah jvaraa dvaye'pi baadhante praaptyaapraaptyaa naram kramaat

काम, क्रोध आदि तथा शान्ति, दम आदि लिङ्ग-देह में रहते हैं; ये दोनों प्रकार के ज्वर क्रमशः प्राप्ति और अप्राप्ति से मनुष्य को पीड़ित करते हैं।

Desire, anger and the rest, and calm, restraint and the rest, belong to the subtle body; these fevers of both kinds afflict a man in turn, by getting and by not getting.

स्वं परं च न वेत्त्यात्मा विनष्ट इव कारणे
आगामि दुःखबीजं चेत्येतदिन्द्रेण दर्शितम् ॥ २२६ ॥

svaṃ paraṃ ca na vettyātmā vinaṣṭa iva kāraṇe
āgāmi duḥkhabījaṃ cetyetadindreṇa darśitam || 226 ||

Svam param cha na vettyaatmaa vinashta iva kaarane aagaami duhkhabiijam chetyetadindrena darshitam

'आत्मा कारण-शरीर में मानो नष्ट-सा होकर न अपने को जानता है न दूसरे को, और वह आगामी दुःख का बीज है' — यह इन्द्र ने दिखाया।

'In the causal body the self, as though destroyed, knows neither itself nor another, and it is the seed of sorrow to come' — this Indra showed.

एते ज्वराः शरीरेषु त्रिषु स्वाभाविका मताः
वियोगे तु ज्वरैस्तानि शरीराण्येव नासते ॥ २२७ ॥

ete jvarāḥ śarīreṣu triṣu svābhāvikā matāḥ
viyoge tu jvaraistāni śarīrāṇyeva nāsate || 227 ||

Ete jvaraah shariireshu trishu svaabhaavikaa mataah viyoge tu jvaraistaani shariiraanyeva naasate

ये ज्वर तीनों शरीरों में स्वाभाविक माने गए हैं; और ज्वरों से वियोग होने पर वे शरीर रहते ही नहीं।

These fevers are held natural to the three bodies; and parted from the fevers those bodies do not exist at all.

तन्तोर्वियुज्येत पटो वालेभ्यः कंबलो यथा
मृदो घटस्तथा देहो ज्वरेभ्योऽपीति दृश्यताम् ॥ २२८ ॥

tantorviyujyeta paṭo vālebhyaḥ kaṃbalo yathā
mṛdo ghaṭastathā deho jvarebhyo'pīti dṛśyatām || 228 ||

Tantorviyujyeta pato vaalebhyah kambalo yathaa mrido ghatastathaa deho jvarebhyo'piiti drishyataam

जैसे तन्तु से पट, बालों से कम्बल, और मिट्टी से घड़ा अलग हो जाए — वैसे ही ज्वरों से देह का अलग होना समझना चाहिए।

As cloth would be parted from thread, a blanket from hairs, a pot from clay — so let the body's parting from the fevers be seen.

चिदाभासे स्वतः कोऽपि ज्वरो नाऽस्ति यतश्चितः
प्रकाशैकस्वभावत्वमेव दृष्टं न चेतरत् ॥ २२९ ॥

cidābhāse svataḥ ko'pi jvaro nā'sti yataścitaḥ
prakāśaikasvabhāvatvameva dṛṣṭaṃ na cetarat || 229 ||

Chidaabhaase svatah ko'pi jvaro naa'sti yatashchitah prakaashaikasvabhaavatvameva drishtam na chetarat

चिदाभास में स्वतः कोई ज्वर नहीं है, क्योंकि चित् का एकमात्र स्वभाव प्रकाश ही देखा गया है, और कुछ नहीं।

In the reflection of awareness there is of itself no fever, for the one nature of awareness is seen to be light and nothing else.

चिदाभासेऽप्यसंभाव्या ज्वराः साक्षिणि का कथा
एवमप्येकतां मेने चिदाभासोह्यविद्यया ॥ २३० ॥

cidābhāse'pyasaṃbhāvyā jvarāḥ sākṣiṇi kā kathā
evamapyekatāṃ mene cidābhāsohyavidyayā || 230 ||

Chidaabhaase'pyasambhaavyaa jvaraah saakshini kaa kathaa evamapyekataam mene chidaabhaasohyavidyayaa

जब चिदाभास में भी ज्वर असम्भव हैं, तब साक्षी की तो बात ही क्या? फिर भी चिदाभास ने अविद्या से एकता मान ली।

When fevers are impossible even in the reflection, what of the witness? Yet through nescience the reflection took itself to be one with them.

साक्षिसत्यत्वमध्यस्य स्वेनोपेते वपुस्त्रये
तत्सर्वं वास्तवं स्वस्य स्वरूपमिति मन्यते ॥ २३१ ॥

sākṣisatyatvamadhyasya svenopete vapustraye
tatsarvaṃ vāstavaṃ svasya svarūpamiti manyate || 231 ||

Saakshisatyatvamadhyasya svenopete vapustraye tatsarvam vaastavam svasya svaruupamiti manyate

साक्षी की सत्यता को अपने से युक्त तीनों शरीरों पर आरोपित करके, वह उन सबको अपना वास्तविक स्वरूप मान लेता है।

Superimposing the witness's reality upon the three bodies that it has taken to itself, it holds all that to be its own real nature.

एतस्मिन् भ्रान्तिकालेऽयं शरीरेषु ज्वरत्स्वथ
स्वयमेव ज्वरामीति मन्यते हि कुटुंबिवत् ॥ २३२ ॥

etasmin bhrāntikāle'yaṃ śarīreṣu jvaratsvatha
svayameva jvarāmīti manyate hi kuṭuṃbivat || 232 ||

Etasmin bhraantikaale'yam shariireshu jvaratsvatha svayameva jvaraamiiti manyate hi kutumbivat

इस भ्रान्ति के समय शरीरों के ज्वरित होने पर वह 'मैं ही ज्वरित हो रहा हूँ' — ऐसा मानता है, कुटुम्बी की तरह।

At this time of error, when the bodies are in fever, it thinks 'I myself am in fever', like the head of a household.

पुत्रदारेषु तृप्यत्सु तृप्यामीति वृथा यथा
मन्यते पुरुषस्तद्वदाभासोऽप्यभिमन्यते ॥ २३३ ॥

putradāreṣu tṛpyatsu tṛpyāmīti vṛthā yathā
manyate puruṣastadvadābhāso'pyabhimanyate || 233 ||

Putradaareshu tripyatsu tripyaamiiti vrithaa yathaa manyate purushastadvadaabhaaso'pyabhimanyate

जैसे पुत्र और स्त्री के तृप्त होने पर पुरुष व्यर्थ ही 'मैं तृप्त हो रहा हूँ' मानता है, वैसे ही आभास भी अभिमान करता है।

As a man vainly thinks 'I am satisfied' when his children and wife are satisfied, so the reflection too takes it upon itself.

विविच्य भ्रान्तिमुज्झित्वा स्वमप्यगणयन् सदा
चिन्तयन् साक्षिणं कस्माच्छरीरमनुसंज्वरेत् ॥ २३४ ॥

vivicya bhrāntimujjhitvā svamapyagaṇayan sadā
cintayan sākṣiṇaṃ kasmāccharīramanusaṃjvaret || 234 ||

Vivichya bhraantimujjhitvaa svamapyaganayan sadaa chintayan saakshinam kasmaachchhariiramanusamjvaret

विवेक करके, भ्रान्ति छोड़कर, अपने को भी न गिनते हुए, सदा साक्षी का चिन्तन करता हुआ वह शरीर के पीछे क्यों तपे?

Discerning, leaving error behind, not counting even himself, and ever thinking on the witness — why should he burn after the body?

अयथावस्तुसर्पादिज्ञानं हेतुः पलायने
रज्जुज्ञानेऽहिधीध्वस्तौ कृतमप्यनुशोचति ॥ २३५ ॥

ayathāvastusarpādijñānaṃ hetuḥ palāyane
rajjujñāne'hidhīdhvastau kṛtamapyanuśocati || 235 ||

Ayathaavastusarpaadijnaanam hetuh palaayane rajjujnaane'hidhiidhvastau kritamapyanushochati

वस्तु को यथावत् न जानकर साँप आदि का ज्ञान भागने का कारण बनता है; रस्सी का ज्ञान होने पर साँप की बुद्धि नष्ट हो जाती है, फिर भी किया हुआ याद करके वह पछताता है।

Not knowing the thing as it is, the notion of a snake makes one flee; and when the rope is known and the snake-notion is gone, he still regrets what he did.

मिथ्याभियोगदोषस्य प्रायश्चित्तप्रसिद्धये
क्षमापयन्निवात्मानं साक्षिणं शरणं गतः ॥ २३६ ॥

mithyābhiyogadoṣasya prāyaścittaprasiddhaye
kṣamāpayannivātmānaṃ sākṣiṇaṃ śaraṇaṃ gataḥ || 236 ||

Mithyaabhiyogadoshasya praayashchittaprasiddhaye kshamaapayannivaatmaanam saakshinam sharanam gatah

मिथ्या अभियोग के दोष के प्रायश्चित्त की सिद्धि के लिए, मानो अपने को क्षमा कराता हुआ, वह साक्षी की शरण में जाता है।

To make amends for the fault of a false charge, as if begging his own pardon, he takes refuge in the witness.

आवृत्तपापनुत्यर्थं स्नानाद्यावर्त्यते यथा
आवर्तयन्निव ध्यानं सदा साक्षिपरायणः ॥ २३७ ॥

āvṛttapāpanutyarthaṃ snānādyāvartyate yathā
āvartayanniva dhyānaṃ sadā sākṣiparāyaṇaḥ || 237 ||

Aavrittapaapanutyartham snaanaadyaavartyate yathaa aavartayanniva dhyaanam sadaa saakshiparaayanah

जैसे बार-बार किए पाप को दूर करने के लिए स्नान आदि बार-बार किया जाता है, वैसे ही मानो ध्यान को दोहराता हुआ वह सदा साक्षी में लगा रहता है।

As bathing and the rest are repeated to remove a sin repeatedly done, so, as though repeating his meditation, he is always given to the witness.

उपस्थकुष्ठिनी वेश्या विलासेषु विलज्जते
जानतोऽग्रे तथाभासः स्वप्रख्यातौ विलज्जते ॥ २३८ ॥

upasthakuṣṭhinī veśyā vilāseṣu vilajjate
jānato'gre tathābhāsaḥ svaprakhyātau vilajjate || 238 ||

Upasthakushthinii veshyaa vilaaseshu vilajjate jaanato'gre tathaabhaasah svaprakhyaatau vilajjate

जिसकी उपस्थ में कुष्ठ हो, वह वेश्या विलासों में लज्जित होती है; वैसे ही जानने वालों के सामने आभास अपने प्रकट होने पर लज्जित होता है।

A courtesan with leprosy in her parts is ashamed in her dalliance; so the reflection is ashamed when it is found out before those who know.

गृहीतो ब्राह्मणो म्लेच्छैः प्रायश्चित्तं चरन् पुनः
म्लेच्छैः संकीर्यते नैव तथाभासः शरीरकैः ॥ २३९ ॥

gṛhīto brāhmaṇo mlecchaiḥ prāyaścittaṃ caran punaḥ
mlecchaiḥ saṃkīryate naiva tathābhāsaḥ śarīrakaiḥ || 239 ||

Grihiito braahmano mlechchhaih praayashchittam charan punah mlechchhaih samkiiryate naiva tathaabhaasah shariirakaih

म्लेच्छों से पकड़ा गया ब्राह्मण प्रायश्चित्त करके फिर म्लेच्छों से नहीं मिलता; वैसे ही आभास शरीरों से नहीं मिलता।

A brāhmaṇa seized by barbarians, having done penance, does not mix with them again; so the reflection does not mix with the bodies.

यौवराज्ये स्थितो राजपुत्रः साम्राज्यवाञ्छया
राजानुकारी भवति तथा साक्ष्यनुकार्ययम् ॥ २४० ॥

yauvarājye sthito rājaputraḥ sāmrājyavāñchayā
rājānukārī bhavati tathā sākṣyanukāryayam || 240 ||

Yauvaraajye sthito raajaputrah saamraajyavaanchhayaa raajaanukaarii bhavati tathaa saakshyanukaaryayam

जैसे युवराज-पद पर बैठा राजपुत्र साम्राज्य की इच्छा से राजा का अनुकरण करता है, वैसे ही यह साक्षी का अनुकरण करता है।

As a prince set in the place of heir, wishing for the empire, imitates the king, so this one imitates the witness.

यो ब्रह्म वेद ब्रह्मैव भवत्येष इति श्रुतिम्
श्रुत्वा तदेकचित्तः सन् ब्रह्म वेत्ति न चेतरत् ॥ २४१ ॥

yo brahma veda brahmaiva bhavatyeṣa iti śrutim
śrutvā tadekacittaḥ san brahma vetti na cetarat || 241 ||

Yo brahma veda brahmaiva bhavatyesha iti shrutim shrutvaa tadekachittah san brahma vetti na chetarat

'जो ब्रह्म को जानता है वह ब्रह्म ही हो जाता है' — इस श्रुति को सुनकर, उसी में चित्त लगाकर वह ब्रह्म को ही जानता है, और कुछ नहीं।

Hearing the scripture 'he who knows Brahman becomes Brahman', he sets his mind on that alone and knows Brahman and nothing else.

देवत्वकामा ह्यग्न्यादौ प्रविशन्ति यथा तथा
साक्षित्वेनावशेषाय स्वविनाशं स वाञ्छति ॥ २४२ ॥

devatvakāmā hyagnyādau praviśanti yathā tathā
sākṣitvenāvaśeṣāya svavināśaṃ sa vāñchati || 242 ||

Devatvakaamaa hyagnyaadau pravishanti yathaa tathaa saakshitvenaavasheshaaya svavinaasham sa vaanchhati

जैसे देवत्व चाहने वाले अग्नि आदि में प्रवेश करते हैं, वैसे ही साक्षी-रूप से शेष रहने के लिए वह अपने नाश की इच्छा करता है।

As those who long for godhood enter the fire and the rest, so he wishes his own destruction, that he may be left as the witness.

यावत्स्वदेहदाहं स नरत्वं नैव मुञ्चति
यावदारब्धदेहं स्यान्नाभासत्वविमोचनं ॥ २४३ ॥

yāvatsvadehadāhaṃ sa naratvaṃ naiva muñcati
yāvadārabdhadehaṃ syānnābhāsatvavimocanaṃ || 243 ||

Yaavatsvadehadaaham sa naratvam naiva munchati yaavadaarabdhadeham syaannaabhaasatvavimochanam

जब तक अपने देह का दाह न हो तब तक वह मनुष्यता नहीं छोड़ता; और जब तक प्रारब्ध का देह रहे तब तक आभासपन से छुटकारा नहीं होता।

Until his body is burnt he does not give up manhood; and so long as the body of the deeds already begun lasts, there is no release from being a reflection.

रज्जुज्ञानेऽपि कम्पादिः शनैरेवोपशाम्यति
पुनर्मन्दान्धकारे सा रज्जुः क्षिप्तोरगी भवेत् ॥ २४४ ॥

rajjujñāne'pi kampādiḥ śanairevopaśāmyati
punarmandāndhakāre sā rajjuḥ kṣiptoragī bhavet || 244 ||

Rajjujnaane'pi kampaadih shanairevopashaamyati punarmandaandhakaare saa rajjuh kshiptoragii bhavet

रस्सी का ज्ञान हो जाने पर भी काँपना आदि धीरे-धीरे ही शान्त होता है; और मन्द अन्धकार में वही रस्सी फिर फेंके हुए साँप जैसी हो जाती है।

Even when the rope is known, the trembling and the rest subside only slowly; and in faint darkness that same rope becomes again a thrown snake.

एवमारब्धभोगोऽपि शनैः शाम्यति नो हठात्
भोगकाले कदाचित्तु मर्त्योऽहमिति भासते ॥ २४५ ॥

evamārabdhabhogo'pi śanaiḥ śāmyati no haṭhāt
bhogakāle kadācittu martyo'hamiti bhāsate || 245 ||

Evamaarabdhabhogo'pi shanaih shaamyati no hathaat bhogakaale kadaachittu martyo'hamiti bhaasate

इसी प्रकार प्रारब्ध का भोग भी धीरे-धीरे शान्त होता है, हठात् नहीं; भोग के समय कभी-कभी 'मैं मरणधर्मा हूँ' — ऐसा भासता है।

So too the enjoyment of the deeds already begun subsides slowly and not at once; and in the time of enjoyment there sometimes appears the thought 'I am mortal'.

नैतावतापराधेन तत्त्वज्ञानम् विनश्यति
जीवन्मुक्तिव्रतं नेदं किंतु वस्तुस्थितिः खलु ॥ २४६ ॥

naitāvatāparādhena tattvajñānam vinaśyati
jīvanmuktivrataṃ nedaṃ kiṃtu vastusthitiḥ khalu || 246 ||

Naitaavataaparaadhena tattvajnaanam vinashyati jiivanmuktivratam nedam kimtu vastusthitih khalu

इतने अपराध से तत्त्वज्ञान नष्ट नहीं हो जाता; यह जीवन्मुक्ति का कोई व्रत नहीं, बल्कि वस्तु की स्थिति ही है।

By so small a lapse the knowledge of truth is not destroyed; this is no vow of living freedom but simply the way things stand.

दशमोऽपि शिरस्ताडं रुदन् बुद्ध्वा न रोदिति
शिरोव्रणस्तु मासेन शनैश्शाम्यति नो तदा ॥ २४७ ॥

daśamo'pi śirastāḍaṃ rudan buddhvā na roditi
śirovraṇastu māsena śanaiśśāmyati no tadā || 247 ||

Dashamo'pi shirastaadam rudan buddhvaa na roditi shirovranastu maasena shanaishshaamyati no tadaa

दसवाँ भी सिर पीटकर रोता था; जान लेने पर नहीं रोता; पर सिर का घाव एक महीने में धीरे-धीरे शान्त होता है, उस समय नहीं।

The tenth man too beat his head and wept; knowing the truth he weeps no more; yet the wound on his head heals slowly in a month, not at once.

दशमामृतिलाभेन जातो हर्षो व्रणव्यथाम्
तिरोधत्ते मुक्तिलाभस्तथा प्रारब्धदुःखिताम् ॥ २४८ ॥

daśamāmṛtilābhena jāto harṣo vraṇavyathām
tirodhatte muktilābhastathā prārabdhaduḥkhitām || 248 ||

Dashamaamritilaabhena jaato harsho vranavyathaam tirodhatte muktilaabhastathaa praarabdhaduhkhitaam

दसवें के जीवित मिल जाने से उत्पन्न हर्ष घाव की पीड़ा को ढँक देता है; वैसे ही मुक्ति का लाभ प्रारब्ध के दुःख को ढँक देता है।

The joy of finding the tenth alive hides the pain of the wound; so the winning of release hides the sorrow of the deeds already begun.

व्रताभावाद्यथाऽध्यासस्तथा भूयो विविच्यताम्
रससेवी दिने भुङ्क्ते भूयो भूयो यथा तथा ॥ २४९ ॥

vratābhāvādyathā'dhyāsastathā bhūyo vivicyatām
rasasevī dine bhuṅkte bhūyo bhūyo yathā tathā || 249 ||

Vrataabhaavaadyathaa'dhyaasastathaa bhuuyo vivichyataam rasasevii dine bhunkte bhuuyo bhuuyo yathaa tathaa

व्रत न होने से जैसे अध्यास फिर हो जाता है, वैसे ही फिर विवेक करना चाहिए; जैसे रस का सेवन करने वाला दिन में बार-बार खाता है।

As, there being no vow, the superimposition returns, so let the discernment be made again; as one fond of good food eats again and again in the day.

शमयत्यौषधेनायं दशमः स्वं व्रणं यथा
भोगेन शमयित्वैतत्प्रारब्धं मुच्यते तथा ॥ २५० ॥

śamayatyauṣadhenāyaṃ daśamaḥ svaṃ vraṇaṃ yathā
bhogena śamayitvaitatprārabdhaṃ mucyate tathā || 250 ||

Shamayatyaushadhenaayam dashamah svam vranam yathaa bhogena shamayitvaitatpraarabdham muchyate tathaa

जैसे वह दसवाँ औषधि से अपने घाव को शान्त करता है, वैसे ही भोग से इस प्रारब्ध को शान्त करके वह मुक्त हो जाता है।

As that tenth man heals his wound with medicine, so, quieting the deeds already begun by enjoyment, he is released.

किमिच्छन्नितिवाक्योक्तः शोकमोक्ष उदीरितः
आभासस्य ह्यवस्थैषा षष्ठी तृप्तिस्तु सप्तमी ॥ २५१ ॥

kimicchannitivākyoktaḥ śokamokṣa udīritaḥ
ābhāsasya hyavasthaiṣā ṣaṣṭhī tṛptistu saptamī || 251 ||

Kimichchhannitivaakyoktah shokamoksha udiiritah aabhaasasya hyavasthaishaa shashthii triptistu saptamii

'किसकी इच्छा से' — इस वाक्य से शोक की निवृत्ति कही गई; आभास की यह छठी अवस्था है, और तृप्ति सातवीं।

By the words 'wishing what' the ceasing of grief was declared; this is the sixth state of the reflection, and contentment is the seventh.

सांकुशा विषयैस्तृप्तिरियं तृप्तिर्निरंकुशा
कृतं कृत्यं प्रापणीयं प्राप्तमित्येव तृप्यति ॥ २५२ ॥

sāṃkuśā viṣayaistṛptiriyaṃ tṛptirniraṃkuśā
kṛtaṃ kṛtyaṃ prāpaṇīyaṃ prāptamityeva tṛpyati || 252 ||

Saamkushaa vishayaistriptiriyam triptirniramkushaa kritam krityam praapaniiyam praaptamityeva tripyati

विषयों से होने वाली तृप्ति सांकुश है, यह तृप्ति निरंकुश है; 'जो करना था हो गया, जो पाना था मिल गया' — इसी से वह तृप्त होता है।

Contentment from objects is bounded; this contentment is unbounded — 'what was to be done is done, what was to be got is got' — with this alone he is content.

ऐहिकामुष्मिकव्रातसिद्ध्यै मुक्तेश्च सिद्धये
बहु कृत्ये पुराऽस्याभूत्तत्सर्वमधुना कृतम् ॥ २५३ ॥

aihikāmuṣmikavrātasiddhyai mukteśca siddhaye
bahu kṛtye purā'syābhūttatsarvamadhunā kṛtam || 253 ||

Aihikaamushmikavraatasiddhyai mukteshcha siddhaye bahu kritye puraa'syaabhuuttatsarvamadhunaa kritam

इस लोक और परलोक की वस्तुओं की सिद्धि के लिए और मुक्ति की सिद्धि के लिए पहले इसे बहुत करना था; अब वह सब हो गया।

For the winning of the things of this world and the next, and for the winning of release, he once had much to do; now it is all done.

तदेतत्कृतकृत्यत्वं प्रतियोगिपुरस्सरम्
अनुसन्दधदेवायमेवं तुष्यति नित्यशः ॥ २५४ ॥

tadetatkṛtakṛtyatvaṃ pratiyogipurassaram
anusandadhadevāyamevaṃ tuṣyati nityaśaḥ || 254 ||

Tadetatkritakrityatvam pratiyogipurassaram anusandadhadevaayamevam tushyati nityashah

यही कृतकृत्यता है; प्रतियोगी को सामने रखकर इसका अनुसन्धान करता हुआ ही यह सदा सन्तुष्ट रहता है।

This is the being one who has done what was to be done; holding its opposite before him and following it out, he is content always.

दुःखिनोऽज्ञाः संसरन्तु कामं पुत्राद्यपेक्षया
परमानन्दपूर्णोऽहं संसरामि किमिच्छया ॥ २५५ ॥

duḥkhino'jñāḥ saṃsarantu kāmaṃ putrādyapekṣayā
paramānandapūrṇo'haṃ saṃsarāmi kimicchayā || 255 ||

Duhkhino'jnaah samsarantu kaamam putraadyapekshayaa paramaanandapuurno'ham samsaraami kimichchhayaa

दुःखी अज्ञानी पुत्र आदि की अपेक्षा से भले ही संसार में भटकें; मैं तो परमानन्द से पूर्ण हूँ — किस इच्छा से संसार में भटकूँ?

Let the wretched ignorant wander in the world, longing for sons and the rest; I am full of the highest bliss — with what wish should I wander?

अनुतिष्ठन्तु कर्माणि परलोकयियासवः
सर्वलोकात्मकः कस्मादनुतिष्ठामि किं कथं ॥ २५६ ॥

anutiṣṭhantu karmāṇi paralokayiyāsavaḥ
sarvalokātmakaḥ kasmādanutiṣṭhāmi kiṃ kathaṃ || 256 ||

Anutishthantu karmaani paralokayiyaasavah sarvalokaatmakah kasmaadanutishthaami kim katham

परलोक जाने की इच्छा वाले कर्मों का अनुष्ठान करें; मैं सब लोकों का आत्मा हूँ — किसलिए, क्या और कैसे अनुष्ठान करूँ?

Let those who wish to go to another world perform their rites; I am the Self of all the worlds — for what, and what, and how should I perform?

व्याचक्षतां ते शास्त्राणि वेदानध्यापयन्तु वा
येऽत्राधिकारिणो मे तु नाधिकारोऽक्रियत्वतः ॥ २५७ ॥

vyācakṣatāṃ te śāstrāṇi vedānadhyāpayantu vā
ye'trādhikāriṇo me tu nādhikāro'kriyatvataḥ || 257 ||

Vyaachakshataam te shaastraani vedaanadhyaapayantu vaa ye'traadhikaarino me tu naadhikaaro'kriyatvatah

जो यहाँ अधिकारी हैं वे शास्त्रों का व्याख्यान करें या वेद पढ़ाएँ; मेरा तो कोई अधिकार नहीं, क्योंकि मैं अक्रिय हूँ।

Let those who are fit expound the treatises or teach the Vedas; I have no office there, for I am without action.

निद्राभिक्षे स्नानशौचे नेच्छामि न करोमि च
द्रष्टारश्चेत्कल्पयन्ति किं मे स्यादन्यकल्पनात् ॥ २५८ ॥

nidrābhikṣe snānaśauce necchāmi na karomi ca
draṣṭāraścetkalpayanti kiṃ me syādanyakalpanāt || 258 ||

Nidraabhikshe snaanashauche nechchhaami na karomi cha drashtaarashchetkalpayanti kim me syaadanyakalpanaat

निद्रा, भिक्षा, स्नान और शौच — इन्हें मैं न चाहता हूँ न करता हूँ; यदि देखने वाले ऐसी कल्पना करें तो दूसरों की कल्पना से मेरा क्या?

Sleep, alms, bathing and cleansing — I neither wish them nor do them; and if onlookers fancy so, what is another's fancy to me?

गुञ्जापुञ्जादि दह्येत नान्यारोपितवह्निना
नान्यारोपितसंसारधर्मानेवमहं भजे ॥ २५९ ॥

guñjāpuñjādi dahyeta nānyāropitavahninā
nānyāropitasaṃsāradharmānevamahaṃ bhaje || 259 ||

Gunjaapunjaadi dahyeta naanyaaropitavahninaa naanyaaropitasamsaaradharmaanevamaham bhaje

घुँघची के ढेर आदि दूसरे के आरोपित अग्नि से नहीं जलते; वैसे ही मैं दूसरों के आरोपित संसार-धर्मों को नहीं भोगता।

A heap of gunja berries is not burnt by a fire another imagines; so I do not take on the marks of the world that others impose.

शृण्वन्त्वज्ञाततत्त्वास्ते जानन् कस्माच्छृणोम्यहम्
मन्यन्ताम् संशयापन्ना न मन्येऽहमसंशयः ॥ २६० ॥

śṛṇvantvajñātatattvāste jānan kasmācchṛṇomyaham
manyantām saṃśayāpannā na manye'hamasaṃśayaḥ || 260 ||

Shrinvantvajnaatatattvaaste jaanan kasmaachchhrinomyaham manyantaam samshayaapannaa na manye'hamasamshayah

जिन्होंने तत्त्व नहीं जाना वे सुनें; मैं तो जानता हूँ — किसलिए सुनूँ? संशय वाले मनन करें; मैं निःसंशय हूँ, मनन नहीं करता।

Let those who do not know the truth hear it; knowing, why should I hear? Let those in doubt reflect; being without doubt, I do not reflect.

विपर्यस्तो निदिध्यासेत्किम् ध्यानमविपर्ययात्
देहात्मत्वविपर्यासं न कदाचिद्भजाम्यहम् ॥ २६१ ॥

viparyasto nididhyāsetkim dhyānamaviparyayāt
dehātmatvaviparyāsaṃ na kadācidbhajāmyaham || 261 ||

Viparyasto nididhyaasetkim dhyaanamaviparyayaat dehaatmatvaviparyaasam na kadaachidbhajaamyaham

विपर्यय वाला निदिध्यासन करे; विपर्यय न होने पर ध्यान किसलिए? देह में आत्मबुद्धि का विपर्यय मैं कभी नहीं भजता।

Let him who is in error meditate; where there is no error, what need of meditation? I never fall into the error of taking the body for the Self.

अहं मनुष्य इत्यादिव्यवहारो विनाऽप्यमुम्
विपर्यासं चिराभ्यस्तवासनातोऽवकल्पते ॥ २६२ ॥

ahaṃ manuṣya ityādivyavahāro vinā'pyamum
viparyāsaṃ cirābhyastavāsanāto'vakalpate || 262 ||

Aham manushya ityaadivyavahaaro vinaa'pyamum viparyaasam chiraabhyastavaasanaato'vakalpate

'मैं मनुष्य हूँ' आदि व्यवहार इस विपर्यय के बिना भी, चिरकाल के अभ्यास से बनी वासना से, बन जाता है।

The way of speaking 'I am a man' and the rest goes on even without that error, through the habit formed by long practice.

प्रारब्धकर्मणि क्षीणे व्यवहारो निवर्तते
कर्माक्षये त्वसौ नैव शाम्येद्ध्यानसहस्रतः ॥ २६३ ॥

prārabdhakarmaṇi kṣīṇe vyavahāro nivartate
karmākṣaye tvasau naiva śāmyeddhyānasahasrataḥ || 263 ||

Praarabdhakarmani kshiine vyavahaaro nivartate karmaakshaye tvasau naiva shaamyeddhyaanasahasratah

प्रारब्ध कर्म के क्षीण होने पर व्यवहार निवृत्त हो जाता है; कर्म के क्षय बिना वह हज़ारों ध्यानों से भी शान्त नहीं होता।

When the deeds already begun are spent, the dealings cease; without their spending they are not stilled by a thousand meditations.

विरलत्वं व्यवहृतेरिष्टं चेद्ध्यानमस्तुते
अबाधिकां व्यवहृतिं पश्यन् ध्यायाम्यहं कुतः ॥ २६४ ॥

viralatvaṃ vyavahṛteriṣṭaṃ ceddhyānamastute
abādhikāṃ vyavahṛtiṃ paśyan dhyāyāmyahaṃ kutaḥ || 264 ||

Viralatvam vyavahriterishtam cheddhyaanamastute abaadhikaam vyavahritim pashyan dhyaayaamyaham kutah

यदि व्यवहार का विरल होना इष्ट हो तो ध्यान भले हो; पर व्यवहार को बाधक न देखता हुआ मैं किसलिए ध्यान करूँ?

If a thinning of worldly dealing is wanted, let there be meditation; but seeing that dealing does no harm, why should I meditate?

विक्षेपो नास्ति यस्मान्मे न समाधिस्ततो मम
विक्षेपो वा समाधिर्वा मनसः स्याद्विकारिणः ॥ २६५ ॥

vikṣepo nāsti yasmānme na samādhistato mama
vikṣepo vā samādhirvā manasaḥ syādvikāriṇaḥ || 265 ||

Vikshepo naasti yasmaanme na samaadhistato mama vikshepo vaa samaadhirvaa manasah syaadvikaarinah

मुझमें विक्षेप नहीं है, इसलिए समाधि भी नहीं; विक्षेप या समाधि तो विकारी मन के होते हैं।

In me there is no distraction, and so no absorption either; distraction or absorption belong to the changing mind.

नित्यानुभवरूपस्य को वा मेऽनुभवः पृथक्
कृतं कृत्यं प्रापणीयं प्राप्तमित्येव निश्चयः ॥ २६६ ॥

nityānubhavarūpasya ko vā me'nubhavaḥ pṛthak
kṛtaṃ kṛtyaṃ prāpaṇīyaṃ prāptamityeva niścayaḥ || 266 ||

Nityaanubhavaruupasya ko vaa me'nubhavah prithak kritam krityam praapaniiyam praaptamityeva nishchayah

नित्य अनुभव-रूप मुझको कोई पृथक् अनुभव क्या? 'जो करना था हो गया, जो पाना था मिल गया' — यही निश्चय है।

What separate experience is there for me, who am experience itself for ever? 'What was to be done is done, what was to be got is got' — that is the certainty.

व्यवहारो लौकिको वा शास्त्रीयो वान्यथापि वा
ममाकर्तुरलेपस्य यथारब्धं प्रवर्तताम् ॥ २६७ ॥

vyavahāro laukiko vā śāstrīyo vānyathāpi vā
mamākarturalepasya yathārabdhaṃ pravartatām || 267 ||

Vyavahaaro laukiko vaa shaastriiyo vaanyathaapi vaa mamaakarturalepasya yathaarabdham pravartataam

व्यवहार लौकिक हो, शास्त्रीय हो, या और किसी प्रकार का — मुझ अकर्ता और निर्लेप के लिए वह प्रारब्ध के अनुसार चलता रहे।

Be the dealing worldly, or scriptural, or of any other kind — for me, who am no doer and untouched, let it go on as the deeds already begun dictate.

अथवा कृतकृत्योऽपि लोकानुग्रहकाम्यया
शास्त्रीयेणैव मार्गेण वर्तेऽहं मम का क्षतिः ॥ २६८ ॥

athavā kṛtakṛtyo'pi lokānugrahakāmyayā
śāstrīyeṇaiva mārgeṇa varte'haṃ mama kā kṣatiḥ || 268 ||

Athavaa kritakrityo'pi lokaanugrahakaamyayaa shaastriiyenaiva maargena varte'ham mama kaa kshatih

अथवा कृतकृत्य होकर भी, लोगों पर अनुग्रह की इच्छा से, मैं शास्त्रीय मार्ग से ही चलूँ — इसमें मेरी क्या हानि?

Or, though I have done all that was to be done, out of a wish to favour men let me walk by the scriptural path — what loss is that to me?

देवार्चनस्नानशौचभिक्षादौ वर्ततां वपुः
तारं जपतु वाक्तद्वत्पठत्वाम्नायमस्तकम् ॥ २६९ ॥

devārcanasnānaśaucabhikṣādau vartatāṃ vapuḥ
tāraṃ japatu vāktadvatpaṭhatvāmnāyamastakam || 269 ||

Devaarchanasnaanashauchabhikshaadau vartataam vapuh taaram japatu vaaktadvatpathatvaamnaayamastakam

देवार्चन, स्नान, शौच, भिक्षा आदि में शरीर लगा रहे; वाणी प्रणव का जप करे या वेद का मस्तक पढ़े।

Let the body be busy with worship, bathing, cleansing and alms; let speech mutter the praṇava or recite the crown of the Veda.

विष्णुम् ध्यायतु धीर्यद्वा ब्रह्मानन्दे विलीयताम्
साक्ष्यहं किंचिदप्यत्र न कुर्वे नापि कारये ॥ २७० ॥

viṣṇum dhyāyatu dhīryadvā brahmānande vilīyatām
sākṣyahaṃ kiṃcidapyatra na kurve nāpi kāraye || 270 ||

Vishnum dhyaayatu dhiiryadvaa brahmaanande viliiyataam saakshyaham kimchidapyatra na kurve naapi kaaraye

बुद्धि विष्णु का ध्यान करे या ब्रह्मानन्द में लीन हो जाए; मैं साक्षी हूँ, यहाँ कुछ भी न करता हूँ न कराता हूँ।

Let the understanding meditate on Viṣṇu or dissolve in the bliss of Brahman; I am the witness, and here I neither do anything nor make anything be done.

एवं च कलहः कुत्र संभवेत्कर्मिणो मम
विभिन्नविषयत्वेन पूर्वापरसमुद्रवत् ॥ २७१ ॥

evaṃ ca kalahaḥ kutra saṃbhavetkarmiṇo mama
vibhinnaviṣayatvena pūrvāparasamudravat || 271 ||

Evam cha kalahah kutra sambhavetkarmino mama vibhinnavishayatvena puurvaaparasamudravat

तब कर्मी के साथ मेरा कलह कहाँ सम्भव हो? विषय भिन्न होने से — जैसे पूर्व और पश्चिम के समुद्र।

Where then can there be a quarrel between me and the ritualist? Our fields are different, as are the eastern and the western seas.

वपुर्वाग्धीषु निर्बन्धः कर्मणो न तु साक्षिणि
ज्ञानिनः साक्ष्यलेपत्वे निर्बन्धो नेतरत्र हि ॥ २७२ ॥

vapurvāgdhīṣu nirbandhaḥ karmaṇo na tu sākṣiṇi
jñāninaḥ sākṣyalepatve nirbandho netaratra hi || 272 ||

Vapurvaagdhiishu nirbandhah karmano na tu saakshini jnaaninah saakshyalepatve nirbandho netaratra hi

कर्म का आग्रह शरीर, वाणी और बुद्धि में है, साक्षी में नहीं; और ज्ञानी का आग्रह साक्षी के निर्लेप होने में है, अन्यत्र नहीं।

The ritual's insistence is upon body, speech and understanding, not upon the witness; and the knower's insistence is upon the witness's being untouched, and nowhere else.

एवं चान्योन्यवृत्तान्तानभिज्ञौ बधिराविव
विवदेतां बुद्धिमन्तो हसन्त्येव विलोक्य तौ ॥ २७३ ॥

evaṃ cānyonyavṛttāntānabhijñau badhirāviva
vivadetāṃ buddhimanto hasantyeva vilokya tau || 273 ||

Evam chaanyonyavrittaantaanabhijnau badhiraaviva vivadetaam buddhimanto hasantyeva vilokya tau

इस प्रकार एक-दूसरे का वृत्तान्त न जानने वाले, बहरों की तरह, वे दोनों विवाद करें; बुद्धिमान् उन्हें देखकर हँसते ही हैं।

So let the two dispute, each not knowing the other's case, like two deaf men; the wise only laugh to see them.

यं कर्मी न विजानाति साक्षिणं तस्य तत्ववित्
ब्रह्मत्वं बुद्ध्यतां तत्र कर्मिणः किं विहीयते ॥ २७४ ॥

yaṃ karmī na vijānāti sākṣiṇaṃ tasya tatvavit
brahmatvaṃ buddhyatāṃ tatra karmiṇaḥ kiṃ vihīyate || 274 ||

Yam karmii na vijaanaati saakshinam tasya tatvavit brahmatvam buddhyataam tatra karminah kim vihiiyate

जिस साक्षी को कर्मी नहीं जानता, उसी का ब्रह्मत्व तत्त्ववेत्ता जान ले — उसमें कर्मी का क्या घटता है?

Let the knower of truth know the Brahmanhood of that witness whom the ritualist does not know — what is thereby taken from the ritualist?

देहवाग्बुद्धयस्त्यक्ता ज्ञानिनाऽनृतबुद्धितः
कर्मी प्रवर्तयत्वाभिर्ज्ञानिनो हीयतेऽत्र किम् ॥ २७५ ॥

dehavāgbuddhayastyaktā jñāninā'nṛtabuddhitaḥ
karmī pravartayatvābhirjñānino hīyate'tra kim || 275 ||

Dehavaagbuddhayastyaktaa jnaaninaa'nritabuddhitah karmii pravartayatvaabhirjnaanino hiiyate'tra kim

ज्ञानी ने देह, वाणी और बुद्धि को असत्य मानकर छोड़ दिया; कर्मी उन्हीं से प्रवृत्ति कराए — इसमें ज्ञानी का क्या घटता है?

The knower has given up body, speech and understanding, taking them as untrue; let the ritualist set them to work — what is thereby taken from the knower?

प्रवृत्तिर्नोपयुक्ता चेन्निवृत्तिः क्वोपयुज्यते
बोधहेतुर्निवृत्तिश्चेद्बुभुत्सायां तथेतरा ॥ २७६ ॥

pravṛttirnopayuktā cennivṛttiḥ kvopayujyate
bodhaheturnivṛttiścedbubhutsāyāṃ tathetarā || 276 ||

Pravrittirnopayuktaa chennivrittih kvopayujyate bodhaheturnivrittishchedbubhutsaayaam tathetaraa

यदि प्रवृत्ति उपयोगी नहीं तो निवृत्ति कहाँ उपयोगी होगी? यदि निवृत्ति बोध का हेतु है तो जानने की इच्छा में दूसरी भी वैसी ही है।

If engaging is of no use, where is withdrawing of use? If withdrawing is a cause of knowledge, then for one who wishes to know, the other is as good.

बुद्धश्चेन्न बुभुत्सेत नाप्यसौ बुध्यते पुनः
अबाधादनुवर्तेत बोधो नत्वन्यसाधनम् ॥ २७७ ॥

buddhaścenna bubhutseta nāpyasau budhyate punaḥ
abādhādanuvarteta bodho natvanyasādhanam || 277 ||

Buddhashchenna bubhutseta naapyasau budhyate punah abaadhaadanuvarteta bodho natvanyasaadhanam

जो जान चुका वह जानने की इच्छा नहीं करता, न फिर जानता है; बाध न होने से बोध बना रहता है, दूसरे साधन से नहीं।

He who has known does not wish to know, nor does he know again; knowledge continues because nothing sets it aside, not by any other means.

नाविद्या नापि तत्कार्यं बोधं बाधितुमर्हति
पुरैव तत्त्वबोधेन बाधिते ते उभे यतः ॥ २७८ ॥

nāvidyā nāpi tatkāryaṃ bodhaṃ bādhitumarhati
puraiva tattvabodhena bādhite te ubhe yataḥ || 278 ||

Naavidyaa naapi tatkaaryam bodham baadhitumarhati puraiva tattvabodhena baadhite te ubhe yatah

न अविद्या, न उसका कार्य बोध को बाधित कर सकते हैं; क्योंकि वे दोनों पहले ही तत्त्वबोध से बाधित हो चुके हैं।

Neither nescience nor its work can set knowledge aside; for both have already been set aside by the knowledge of truth.

बाधितं दृश्यतामक्षैस्तेन बाधो न शक्यते
जीवन्नाखुर्न मार्जारं हन्ति हन्यात्कथं मृतः ॥ २७९ ॥

bādhitaṃ dṛśyatāmakṣaistena bādho na śakyate
jīvannākhurna mārjāraṃ hanti hanyātkathaṃ mṛtaḥ || 279 ||

Baadhitam drishyataamakshaistena baadho na shakyate jiivannaakhurna maarjaaram hanti hanyaatkatham mritah

जो बाधित हो चुका वह भले आँखों से दिखे, पर उससे बाध नहीं किया जा सकता; जीवित चूहा बिल्ली को नहीं मारता, तो मरा हुआ कैसे मारेगा?

What has been set aside may still be seen by the eyes, but by it no setting aside can be done; a living mouse does not kill a cat — how should a dead one?

अपि पाशुपतास्त्रेण विद्धश्चेन्न ममार यः
निष्फलेषुविनुन्नांगो नङ्क्ष्यतीत्यत्र का प्रमा ॥ २८० ॥

api pāśupatāstreṇa viddhaścenna mamāra yaḥ
niṣphaleṣuvinunnāṃgo naṅkṣyatītyatra kā pramā || 280 ||

Api paashupataastrena viddhashchenna mamaara yah nishphaleshuvinunnaamgo nankshyatiityatra kaa pramaa

जो पाशुपत अस्त्र से बिंधकर भी नहीं मरा, वह निष्फल बाणों से अंग बिंधकर नष्ट हो जाएगा — इसमें क्या प्रमाण है?

He who did not die though pierced by the weapon of Paśupati — what proof is there that he will perish with his limbs struck by useless arrows?

आदावविद्यया चित्रैः स्वकार्यैर्जृम्भमाणया
युद्ध्वा बोधोऽजयत्सोऽद्य सुदृढो बाध्यतां कथम् ॥ २८१ ॥

ādāvavidyayā citraiḥ svakāryairjṛmbhamāṇayā
yuddhvā bodho'jayatso'dya sudṛḍho bādhyatāṃ katham || 281 ||

Aadaavavidyayaa chitraih svakaaryairjrimbhamaanayaa yuddhvaa bodho'jayatso'dya sudridho baadhyataam katham

पहले अपने विचित्र कार्यों के साथ फैलती हुई अविद्या से युद्ध करके बोध ने जीत लिया; अब वह सुदृढ़ है — वह कैसे बाधित हो?

At first knowledge fought with nescience, spreading with its manifold works, and conquered; now it is firm — how should it be set aside?

तिष्ठन्त्वज्ञानतत्कार्यशवा बोधेन मारिताः
न भीतिर्बोधसम्राजः कीर्तिः प्रत्युत तस्य तैः ॥ २८२ ॥

tiṣṭhantvajñānatatkāryaśavā bodhena māritāḥ
na bhītirbodhasamrājaḥ kīrtiḥ pratyuta tasya taiḥ || 282 ||

Tishthantvajnaanatatkaaryashavaa bodhena maaritaah na bhiitirbodhasamraajah kiirtih pratyuta tasya taih

अज्ञान और उसके कार्यों के शव, जो बोध से मारे गए, पड़े रहें; बोध-सम्राट् को उनसे भय नहीं, उल्टे उनसे उसकी कीर्ति है।

Let the corpses of ignorance and its works, slain by knowledge, lie there; the emperor knowledge has no fear of them — rather they are his fame.

य एवमतिशूरेण बोधेन न वियुज्यते
प्रवृत्त्या वा निवृत्त्या वा देहादिगतयाऽस्य किम् ॥ २८३ ॥

ya evamatiśūreṇa bodhena na viyujyate
pravṛttyā vā nivṛttyā vā dehādigatayā'sya kim || 283 ||

Ya evamatishuurena bodhena na viyujyate pravrittyaa vaa nivrittyaa vaa dehaadigatayaa'sya kim

जो इस प्रकार अत्यन्त शूर बोध से वियुक्त नहीं होता, उसका देह आदि की प्रवृत्ति या निवृत्ति से क्या?

For him who is not parted from such a most valiant knowledge, what is the engaging or withdrawing of body and the rest?

प्रवृत्तावाग्रहो न्याय्यो बोधहीनस्य सर्वथा
स्वर्गाय वापवर्गाय यतितव्यं यतो नृभिः ॥ २८४ ॥

pravṛttāvāgraho nyāyyo bodhahīnasya sarvathā
svargāya vāpavargāya yatitavyaṃ yato nṛbhiḥ || 284 ||

Pravrittaavaagraho nyaayyo bodhahiinasya sarvathaa svargaaya vaapavargaaya yatitavyam yato nribhih

प्रवृत्ति में आग्रह उसी के लिए न्याय्य है जो सर्वथा बोध से रहित है; क्योंकि मनुष्यों को स्वर्ग या मोक्ष के लिए यत्न करना चाहिए।

Insistence on engaging is right only for one wholly without knowledge; for men must strive either for heaven or for release.

विद्वांश्चेत्तादृशां मध्ये तिष्ठेत्तदनुरोधतः
कायेन मनसा वाचा करोत्येवाखिलाः क्रियाः ॥ २८५ ॥

vidvāṃścettādṛśāṃ madhye tiṣṭhettadanurodhataḥ
kāyena manasā vācā karotyevākhilāḥ kriyāḥ || 285 ||

Vidvaamshchettaadrishaam madhye tishthettadanurodhatah kaayena manasaa vaachaa karotyevaakhilaah kriyaah

यदि विद्वान् ऐसे लोगों के बीच रहे, तो उनके अनुरोध से शरीर, मन और वाणी से समस्त क्रियाएँ करता ही है।

If the knower lives among such people, then out of regard for them he does all the acts with body, mind and speech.

एष मध्ये बुभुत्सूनां यदा तिष्ठेत्तदा पुनः
बोधायैषां क्रियाः सर्वा दूषयंस्त्यजतु स्वयम् ॥ २८६ ॥

eṣa madhye bubhutsūnāṃ yadā tiṣṭhettadā punaḥ
bodhāyaiṣāṃ kriyāḥ sarvā dūṣayaṃstyajatu svayam || 286 ||

Esha madhye bubhutsuunaam yadaa tishthettadaa punah bodhaayaishaam kriyaah sarvaa duushayamstyajatu svayam

और जब वह जानने की इच्छा वालों के बीच रहे, तब उनके बोध के लिए सारी क्रियाओं का दोष दिखाता हुआ स्वयं उन्हें छोड़ दे।

And when he lives among those who wish to know, then, for their knowledge, let him show the fault in all acts and himself give them up.

अविद्वदनुसारेण वृत्तिर्बुद्धस्य युज्यते
स्तनंधयानुसारेण वर्तते तत्पिता यतः ॥ २८७ ॥

avidvadanusāreṇa vṛttirbuddhasya yujyate
stanaṃdhayānusāreṇa vartate tatpitā yataḥ || 287 ||

Avidvadanusaarena vrittirbuddhasya yujyate stanamdhayaanusaarena vartate tatpitaa yatah

अज्ञानी के अनुसार ज्ञानी का बर्ताव उचित है; क्योंकि पिता भी दूध पीते बालक के अनुसार ही बर्ताव करता है।

It is fitting that the knower behave as the ignorant do; for a father too behaves according to his suckling child.

अधिक्षिप्तस्ताडितो वा बालेन स्वपिता तदा
न क्लिश्नाति न कुप्येत बालं प्रत्युत लालयेत् ॥ २८८ ॥

adhikṣiptastāḍito vā bālena svapitā tadā
na kliśnāti na kupyeta bālaṃ pratyuta lālayet || 288 ||

Adhikshiptastaadito vaa baalena svapitaa tadaa na klishnaati na kupyeta baalam pratyuta laalayet

बालक से गाली सुनकर या पिटकर भी उसका पिता न क्लेश पाता है न क्रुद्ध होता है, उल्टे बालक को दुलारता है।

Though abused or struck by his child, the father is neither distressed nor angry, but rather fondles the child.

निन्दितः स्तूयमानो वा विद्वानज्ञैर्न निन्दति
न स्तौति किंतु तेषां स्याद्यथा बोधस्तथाचरेत् ॥ २८९ ॥

ninditaḥ stūyamāno vā vidvānajñairna nindati
na stauti kiṃtu teṣāṃ syādyathā bodhastathācaret || 289 ||

Ninditah stuuyamaano vaa vidvaanajnairna nindati na stauti kimtu teshaam syaadyathaa bodhastathaacharet

अज्ञानियों से निन्दा या स्तुति पाकर विद्वान् न निन्दा करता है न स्तुति; बल्कि जिससे उनका बोध हो, वैसा आचरण करता है।

Blamed or praised by the ignorant, the knower neither blames nor praises, but acts in whatever way may bring them knowledge.

येनायं नटनेनात्र बुध्यते कार्यमेव तत्
अज्ञप्रबोधान्नैवान्यत्कार्यमस्त्यत्र तद्विदः ॥ २९० ॥

yenāyaṃ naṭanenātra budhyate kāryameva tat
ajñaprabodhānnaivānyatkāryamastyatra tadvidaḥ || 290 ||

Yenaayam natanenaatra budhyate kaaryameva tat ajnaprabodhaannaivaanyatkaaryamastyatra tadvidah

जिस अभिनय से यहाँ वे जान लें, वही करने योग्य है; अज्ञानियों के प्रबोध के सिवा तत्त्ववेत्ता का यहाँ कोई और कार्य नहीं।

Whatever play makes them understand here, that is what should be done; for the knower of truth there is no other work here than awakening the ignorant.

कृतकृत्यतया तृप्तः प्राप्तप्राप्यतया पुनः
तृप्यन्नेवं स्वमनसा मन्यतेऽसौ निरन्तरम् ॥ २९१ ॥

kṛtakṛtyatayā tṛptaḥ prāptaprāpyatayā punaḥ
tṛpyannevaṃ svamanasā manyate'sau nirantaram || 291 ||

Kritakrityatayaa triptah praaptapraapyatayaa punah tripyannevam svamanasaa manyate'sau nirantaram

कृतकृत्यता से तृप्त, और प्राप्तव्य के प्राप्त हो जाने से फिर तृप्त — ऐसा वह अपने मन में निरन्तर मानता रहता है।

Content that all is done, and content again that what was to be got is got — so he thinks within his own mind without ceasing.

धन्योऽहं धन्योऽहं नित्यं स्वात्मानमञ्जसा वेद्मि
धन्योऽहं धन्योऽहं ब्रह्मानन्दो विभाति मे स्पष्टम् ॥ २९२ ॥

dhanyo'haṃ dhanyo'haṃ nityaṃ svātmānamañjasā vedmi
dhanyo'haṃ dhanyo'haṃ brahmānando vibhāti me spaṣṭam || 292 ||

Dhanyo'ham dhanyo'ham nityam svaatmaanamanjasaa vedmi dhanyo'ham dhanyo'ham brahmaanando vibhaati me spashtam

धन्य हूँ मैं, धन्य हूँ मैं — नित्य अपने आत्मा को मैं सहज ही जानता हूँ; धन्य हूँ मैं, धन्य हूँ मैं — ब्रह्मानन्द मुझे स्पष्ट भासता है।

Blessed am I, blessed am I — I know my own Self directly and always; blessed am I, blessed am I — the bliss of Brahman shines plain to me.

धन्योऽहं धन्योऽहं दुःखं सांसारिकं न वीक्षेऽद्य
धन्योऽहं धन्योऽहं स्वस्याज्ञानं पलायितं क्वापि ॥ २९३ ॥

dhanyo'haṃ dhanyo'haṃ duḥkhaṃ sāṃsārikaṃ na vīkṣe'dya
dhanyo'haṃ dhanyo'haṃ svasyājñānaṃ palāyitaṃ kvāpi || 293 ||

Dhanyo'ham dhanyo'ham duhkham saamsaarikam na viikshe'dya dhanyo'ham dhanyo'ham svasyaajnaanam palaayitam kvaapi

धन्य हूँ मैं, धन्य हूँ मैं — आज मैं संसार का दुःख नहीं देखता; धन्य हूँ मैं, धन्य हूँ मैं — मेरा अज्ञान कहीं भाग गया।

Blessed am I, blessed am I — today I see no sorrow of the world; blessed am I, blessed am I — my ignorance has fled somewhere away.

धन्योऽहं धन्योऽहं कर्तव्यं न विद्यते किंचित्
धन्योऽहं धन्योऽहं प्राप्तव्यं सर्वमद्य संपन्नम् ॥ २९४ ॥

dhanyo'haṃ dhanyo'haṃ kartavyaṃ na vidyate kiṃcit
dhanyo'haṃ dhanyo'haṃ prāptavyaṃ sarvamadya saṃpannam || 294 ||

Dhanyo'ham dhanyo'ham kartavyam na vidyate kimchit dhanyo'ham dhanyo'ham praaptavyam sarvamadya sampannam

धन्य हूँ मैं, धन्य हूँ मैं — मेरे लिए कुछ भी करने योग्य नहीं बचा; धन्य हूँ मैं, धन्य हूँ मैं — जो पाना था वह सब आज मिल गया।

Blessed am I, blessed am I — nothing is left for me to do; blessed am I, blessed am I — all that was to be got is got today.

धन्योऽहं धन्योऽहं तृप्तेर्मे कोपमा भवेल्लोके
धन्योऽहं धन्योऽहं धन्यो धन्यः पुनः पुनर्धन्यः ॥ २९५ ॥

dhanyo'haṃ dhanyo'haṃ tṛpterme kopamā bhavelloke
dhanyo'haṃ dhanyo'haṃ dhanyo dhanyaḥ punaḥ punardhanyaḥ || 295 ||

Dhanyo'ham dhanyo'ham tripterme kopamaa bhavelloke dhanyo'ham dhanyo'ham dhanyo dhanyah punah punardhanyah

धन्य हूँ मैं, धन्य हूँ मैं — लोक में मेरी तृप्ति की कौन उपमा हो? धन्य हूँ मैं, धन्य हूँ मैं — धन्य, धन्य, बार-बार धन्य।

Blessed am I, blessed am I — what likeness in the world is there for my contentment? Blessed am I, blessed am I — blessed, blessed, again and again blessed.

अहो पुण्यमहो पुण्यं फलितं फलितं दृढम्
अस्य पुण्यस्य सम्पत्तेरहो वयमहो वयम् ॥ २९६ ॥

aho puṇyamaho puṇyaṃ phalitaṃ phalitaṃ dṛḍham
asya puṇyasya sampatteraho vayamaho vayam || 296 ||

Aho punyamaho punyam phalitam phalitam dridham asya punyasya sampatteraho vayamaho vayam

अहो पुण्य, अहो पुण्य — वह दृढ़ रूप से फलित हुआ, फलित हुआ; इस पुण्य की सम्पत्ति से अहो हम, अहो हम!

O the merit, O the merit — it has borne fruit, borne fruit indeed; by the wealth of this merit, O we, O we!

अहो शास्त्रमहो शास्त्रमहो गुरुरहो गुरुः
अहो ज्ञानमहो ज्ञानमहो सुखमहो सुखम् ॥ २९७ ॥

aho śāstramaho śāstramaho gururaho guruḥ
aho jñānamaho jñānamaho sukhamaho sukham || 297 ||

Aho shaastramaho shaastramaho gururaho guruh aho jnaanamaho jnaanamaho sukhamaho sukham

अहो शास्त्र, अहो शास्त्र; अहो गुरु, अहो गुरु; अहो ज्ञान, अहो ज्ञान; अहो सुख, अहो सुख!

O the scripture, O the scripture; O the teacher, O the teacher; O the knowledge, O the knowledge; O the happiness, O the happiness!

तृप्तिदीपमिमं नित्यं येऽनुसन्दधते बुधाः
ब्रह्मानन्दे निमज्जन्तस्ते तृप्यन्ति निरन्तरम् ॥ २९८ ॥

tṛptidīpamimaṃ nityaṃ ye'nusandadhate budhāḥ
brahmānande nimajjantaste tṛpyanti nirantaram || 298 ||

Triptidiipamimam nityam ye'nusandadhate budhaah brahmaanande nimajjantaste tripyanti nirantaram

जो बुद्धिमान् इस 'तृप्तिदीप' का नित्य अनुसन्धान करते हैं, वे ब्रह्मानन्द में डूबते हुए निरन्तर तृप्त रहते हैं।

The wise who constantly follow out this Lamp of Contentment, sinking into the bliss of Brahman, are content without ceasing.

खादित्यदीपिते कुड्ये दर्पणादित्यदीप्तिवत्
कूटस्थभासितो देहो धीस्थजीवेन भास्यते ॥ १ ॥

khādityadīpite kuḍye darpaṇādityadīptivat
kūṭasthabhāsito deho dhīsthajīvena bhāsyate || 1 ||

Khaadityadiipite kudye darpanaadityadiiptivat kuutasthabhaasito deho dhiisthajiivena bhaasyate

जैसे सूर्य से प्रकाशित दीवार पर दर्पण से परावर्तित सूर्य की चमक पड़ती है, वैसे ही कूटस्थ से भासित देह बुद्धिस्थ जीव से भासित होता है।

As on a wall lit by the sun there falls the sun's light reflected from a mirror, so the body, lit by the unchanging one, is lit by the soul seated in the understanding.

अनेकदर्पणादित्यदीप्तीनां बहुसन्धिषु
इतरा व्यज्यते तासामभावेऽपि प्रकाशते ॥ २ ॥

anekadarpaṇādityadīptīnāṃ bahusandhiṣu
itarā vyajyate tāsāmabhāve'pi prakāśate || 2 ||

Anekadarpanaadityadiiptiinaam bahusandhishu itaraa vyajyate taasaamabhaave'pi prakaashate

अनेक दर्पणों से आई सूर्य की चमकों की जो अनेक सन्धियाँ हैं, उनमें दूसरी चमक व्यक्त होती है; और उन चमकों के अभाव में भी वह प्रकाशित रहती है।

In the many joins between the sun's lights reflected from many mirrors, the other light is made plain; and it shines too where those lights are absent.

चिदाभासविशिष्टानां तथानेकधियामसौ
सन्धिं धियामभावं च भासयन् प्रविविच्यताम् ॥ ३ ॥

cidābhāsaviśiṣṭānāṃ tathānekadhiyāmasau
sandhiṃ dhiyāmabhāvaṃ ca bhāsayan pravivicyatām || 3 ||

Chidaabhaasavishishtaanaam tathaanekadhiyaamasau sandhim dhiyaamabhaavam cha bhaasayan pravivichyataam

वैसे ही चिदाभास से विशिष्ट अनेक बुद्धियों की सन्धि को और अभाव को भासित करता हुआ यह — इसका विवेचन करना चाहिए।

So too, lighting up both the joins between the many understandings marked by the reflection of awareness, and their absence — this is to be sifted out.

घटैकाकारधीस्था चिद्घटमेवावभासयेत्
घटस्य ज्ञातता ब्रह्मचैतन्येनावभासते ॥ ४ ॥

ghaṭaikākāradhīsthā cidghaṭamevāvabhāsayet
ghaṭasya jñātatā brahmacaitanyenāvabhāsate || 4 ||

Ghataikaakaaradhiisthaa chidghatamevaavabhaasayet ghatasya jnaatataa brahmachaitanyenaavabhaasate

घड़े के एक आकार वाली बुद्धि में स्थित चित् घड़े को ही भासित करेगी; और घड़े का ज्ञात होना ब्रह्म-चैतन्य से भासित होता है।

The awareness seated in the understanding shaped as a pot lights the pot alone; but the pot's being known is lit by the awareness that is Brahman.

अज्ञातत्वेन ज्ञातोऽयं घटो बुद्ध्युदयात्पुरा
ब्रह्मणैवोपरिष्टात्तु ज्ञातत्वेनेत्यसौ भिदा ॥ ५ ॥

ajñātatvena jñāto'yaṃ ghaṭo buddhyudayātpurā
brahmaṇaivopariṣṭāttu jñātatvenetyasau bhidā || 5 ||

Ajnaatatvena jnaato'yam ghato buddhyudayaatpuraa brahmanaivoparishtaattu jnaatatvenetyasau bhidaa

बुद्धि के उदय से पहले यह घड़ा अज्ञात रूप से ज्ञात था, और बाद में ज्ञात रूप से — दोनों ही ब्रह्म से; यही अन्तर है।

Before the understanding rose, this pot was known as unknown, and afterwards as known — both by Brahman alone; this is the difference.

चिदाभासान्तधीवृत्तिर्ज्ञानं लोहान्तकुन्तवत्
जाड्यमज्ञानमेताभ्यां व्याप्तः कुंभो द्विधोच्यते ॥ ६ ॥

cidābhāsāntadhīvṛttirjñānaṃ lohāntakuntavat
jāḍyamajñānametābhyāṃ vyāptaḥ kuṃbho dvidhocyate || 6 ||

Chidaabhaasaantadhiivrittirjnaanam lohaantakuntavat jaadyamajnaanametaabhyaam vyaaptah kumbho dvidhochyate

चिदाभास तक पहुँचने वाली बुद्धि-वृत्ति ज्ञान है, जैसे लोहे तक पहुँचने वाला भाला; जड़ता अज्ञान है; इन दोनों से व्याप्त घड़ा दो प्रकार से कहा जाता है।

The movement of the understanding reaching to the reflection of awareness is knowledge, as a spear reaching to the iron; inertness is ignorance; and the pot pervaded by these two is spoken of in two ways.

अज्ञातो ब्रह्मणा भास्यो ज्ञातः कुंभस्तथा न किम्
ज्ञातत्वजननेनैव चिदाभासपरिक्षयः ॥ ७ ॥

ajñāto brahmaṇā bhāsyo jñātaḥ kuṃbhastathā na kim
jñātatvajananenaiva cidābhāsaparikṣayaḥ || 7 ||

Ajnaato brahmanaa bhaasyo jnaatah kumbhastathaa na kim jnaatatvajananenaiva chidaabhaasaparikshayah

यदि अज्ञात घड़ा ब्रह्म से भासित होता है, तो ज्ञात घड़ा वैसा क्यों नहीं? — क्योंकि ज्ञातता के उत्पन्न होने से ही चिदाभास का क्षय हो जाता है।

If the unknown pot is lit by Brahman, why not the known one too? Because with the arising of knownness the reflection of awareness is spent.

आभासहीनया बुद्ध्या ज्ञातत्वं नैव जन्यते
तादृग्बुद्धेर्विशेषः को मृदादेः स्याद्विकारिणः ॥ ८ ॥

ābhāsahīnayā buddhyā jñātatvaṃ naiva janyate
tādṛgbuddherviśeṣaḥ ko mṛdādeḥ syādvikāriṇaḥ || 8 ||

Aabhaasahiinayaa buddhyaa jnaatatvam naiva janyate taadrigbuddhervisheshah ko mridaadeh syaadvikaarinah

आभास से रहित बुद्धि से ज्ञातता उत्पन्न ही नहीं होती; ऐसी बुद्धि में और विकारी मिट्टी आदि में क्या अन्तर होगा?

By an understanding without the reflection knownness is not produced at all; what difference would there be between such an understanding and changeful clay?

ज्ञात इत्युच्यते कुम्भो मृदा लिप्तो न कुत्रचित्
धीमात्रव्याप्तकुंभस्य ज्ञातत्वं नेष्यते तथा ॥ ९ ॥

jñāta ityucyate kumbho mṛdā lipto na kutracit
dhīmātravyāptakuṃbhasya jñātatvaṃ neṣyate tathā || 9 ||

Jnaata ityuchyate kumbho mridaa lipto na kutrachit dhiimaatravyaaptakumbhasya jnaatatvam neshyate tathaa

मिट्टी से लिपा हुआ घड़ा कहीं भी 'ज्ञात' नहीं कहा जाता; वैसे ही केवल बुद्धि से व्याप्त घड़े की ज्ञातता नहीं मानी जाती।

A pot smeared with clay is nowhere called 'known'; so the knownness of a pot pervaded by the understanding alone is not admitted.

ज्ञातत्वं नाम कुंभेऽतश्चिदाभासफलोदयः
न फलं ब्रह्मचैतन्यं मानात्प्रागपि सत्त्वतः ॥ १० ॥

jñātatvaṃ nāma kuṃbhe'taścidābhāsaphalodayaḥ
na phalaṃ brahmacaitanyaṃ mānātprāgapi sattvataḥ || 10 ||

Jnaatatvam naama kumbhe'tashchidaabhaasaphalodayah na phalam brahmachaitanyam maanaatpraagapi sattvatah

इसलिए घड़े में 'ज्ञातता' नाम चिदाभास के फल का उदय है; ब्रह्म-चैतन्य फल नहीं है, क्योंकि वह प्रमाण से पहले भी विद्यमान है।

So knownness in the pot is the arising of the result of the reflection of awareness; the awareness that is Brahman is not a result, since it is there even before the means of knowledge.

परागर्थप्रमेयेषु या फलत्वेन सम्मता
संवित्सैवेह मेयोऽर्थो वेदान्तोक्तिप्रमाणतः ॥ ११ ॥

parāgarthaprameyeṣu yā phalatvena sammatā
saṃvitsaiveha meyo'rtho vedāntoktipramāṇataḥ || 11 ||

Paraagarthaprameyeshu yaa phalatvena sammataa samvitsaiveha meyo'rtho vedaantoktipramaanatah

'बाहरी वस्तुओं के प्रमेय होने पर जो संवित् फल के रूप में मानी जाती है, वही यहाँ वेदान्त के प्रमाण से मेय अर्थ है।'

'The awareness that is taken as the result when outward things are the objects — that same awareness is here the object, on the authority of the Upaniṣads.'

इति वार्तिककारेण चित्सादृश्यं विवक्षितम्
ब्रह्मचित्फलयोर्भेदः सहस्र्यां विश्रुतो यतः ॥ १२ ॥

iti vārtikakāreṇa citsādṛśyaṃ vivakṣitam
brahmacitphalayorbhedaḥ sahasryāṃ viśruto yataḥ || 12 ||

Iti vaartikakaarena chitsaadrishyam vivakshitam brahmachitphalayorbhedah sahasryaam vishruto yatah

इस प्रकार वार्तिककार ने चित् की सदृशता कही है; क्योंकि ब्रह्म-चित् और फल-चित् का भेद सहस्री में विस्तार से कहा गया है।

By this the author of the gloss meant only a likeness of awareness; for the difference between the awareness that is Brahman and the awareness that is the result is set out at length in the Sahasrī.

आभास उदितस्तस्मात् ज्ञातत्वं जनयेद्घटे
तत्पुनर्ब्रह्मणा भास्यमज्ञातत्ववदेव हि ॥ १३ ॥

ābhāsa uditastasmāt jñātatvaṃ janayedghaṭe
tatpunarbrahmaṇā bhāsyamajñātatvavadeva hi || 13 ||

Aabhaasa uditastasmaat jnaatatvam janayedghate tatpunarbrahmanaa bhaasyamajnaatatvavadeva hi

इसलिए उदित हुआ आभास घड़े में ज्ञातता उत्पन्न करता है; और वह ज्ञातता फिर ब्रह्म से भासित होती है, जैसे अज्ञातता भासित होती थी।

So the risen reflection produces knownness in the pot; and that knownness is in turn lit by Brahman, just as unknownness was.

धीवृत्याभासकुंभानां समूहो भास्यते चिता
कुंभमात्रफलत्वात्स एक आभासतः स्फुरेत् ॥ १४ ॥

dhīvṛtyābhāsakuṃbhānāṃ samūho bhāsyate citā
kuṃbhamātraphalatvātsa eka ābhāsataḥ sphuret || 14 ||

Dhiivrityaabhaasakumbhaanaam samuuho bhaasyate chitaa kumbhamaatraphalatvaatsa eka aabhaasatah sphuret

बुद्धि-वृत्ति, आभास और घड़ा — इनका समूह चित् से भासित होता है; और केवल घड़े का फल होने से वह एक आभास से स्फुरित होता है।

The group of the understanding's movement, the reflection and the pot is lit by awareness; and since the pot alone is the result, that one shines by the reflection.

चैतन्यं द्विगुणं कुम्भे ज्ञातत्वेन स्फुरत्यतः
अन्येऽनुव्यवसायाख्यमाहुरेतद्यथोदितम् ॥ १५ ॥

caitanyaṃ dviguṇaṃ kumbhe jñātatvena sphuratyataḥ
anye'nuvyavasāyākhyamāhuretadyathoditam || 15 ||

Chaitanyam dvigunam kumbhe jnaatatvena sphuratyatah anye'nuvyavasaayaakhyamaahuretadyathoditam

इसलिए घड़े में चैतन्य दो प्रकार से, ज्ञातता के रूप में स्फुरित होता है; दूसरे लोग इसे 'अनुव्यवसाय' कहते हैं, जैसा कहा गया।

Thus in the pot awareness shines twofold, as knownness; others call this the 'after-cognition', as has been said.

घटोऽयमित्यसावुक्तिराभासस्य प्रसादतः
विज्ञातो घट इत्युक्तिर्ब्रह्मानुग्रहतो भवेत् ॥ १६ ॥

ghaṭo'yamityasāvuktirābhāsasya prasādataḥ
vijñāto ghaṭa ityuktirbrahmānugrahato bhavet || 16 ||

Ghato'yamityasaavuktiraabhaasasya prasaadatah vijnaato ghata ityuktirbrahmaanugrahato bhavet

'यह घड़ा है' — यह कथन आभास के प्रसाद से होता है; और 'घड़ा जाना गया' — यह कथन ब्रह्म के अनुग्रह से होता है।

'This is a pot' — this saying comes by the favour of the reflection; 'the pot is known' — this saying comes by the grace of Brahman.

आभासब्रह्मणी देहाद्बहिर्यद्वद्विवेचिते
तद्वदाभासकूटस्थे विविच्येतां वपुष्यपि ॥ १७ ॥

ābhāsabrahmaṇī dehādbahiryadvadvivecite
tadvadābhāsakūṭasthe vivicyetāṃ vapuṣyapi || 17 ||

Aabhaasabrahmanii dehaadbahiryadvadvivechite tadvadaabhaasakuutasthe vivichyetaam vapushyapi

जैसे देह से बाहर आभास और ब्रह्म का विवेचन किया गया, वैसे ही देह में भी आभास और कूटस्थ का विवेचन किया जाए।

As the reflection and Brahman were sifted apart outside the body, so let the reflection and the unchanging one be sifted apart within the body too.

अहंवृत्तौ चिदाभासः कामक्रोधादिकासु च
संव्याप्य वर्तते तप्ते लोहे वह्निर्यथा तथा ॥ १८ ॥

ahaṃvṛttau cidābhāsaḥ kāmakrodhādikāsu ca
saṃvyāpya vartate tapte lohe vahniryathā tathā || 18 ||

Ahamvrittau chidaabhaasah kaamakrodhaadikaasu cha samvyaapya vartate tapte lohe vahniryathaa tathaa

'अहम्' वृत्ति में, और काम-क्रोध आदि वृत्तियों में, चिदाभास व्याप्त होकर रहता है — जैसे तपे हुए लोहे में अग्नि।

In the movement 'I', and in those of desire, anger and the rest, the reflection of awareness abides pervading them — as fire abides in heated iron.

स्वमात्रम् भासयेत्तप्तं लोहं नान्यत्कदाचन
एवमाभाससहिता वृत्तयः स्वस्वभासिकाः ॥ १९ ॥

svamātram bhāsayettaptaṃ lohaṃ nānyatkadācana
evamābhāsasahitā vṛttayaḥ svasvabhāsikāḥ || 19 ||

Svamaatram bhaasayettaptam loham naanyatkadaachana evamaabhaasasahitaa vrittayah svasvabhaasikaah

तपा हुआ लोहा केवल अपने को ही प्रकाशित करता है, कभी किसी और को नहीं; वैसे ही आभास सहित वृत्तियाँ अपने-अपने को ही भासित करती हैं।

Heated iron lights only itself and never anything else; so the mental movements with their reflection light each only itself.

क्रमाद्विच्छिद्य विच्छिद्य जायन्ते वृत्तयोऽखिलाः
सर्वा अपि विलीयन्ते सुप्तिमूर्छासमाधिषु ॥ २० ॥

kramādvicchidya vicchidya jāyante vṛttayo'khilāḥ
sarvā api vilīyante suptimūrchāsamādhiṣu || 20 ||

Kramaadvichchhidya vichchhidya jaayante vrittayo'khilaah sarvaa api viliiyante suptimuurchhaasamaadhishu

सब वृत्तियाँ क्रम से टूट-टूटकर उत्पन्न होती हैं; और सुषुप्ति, मूर्छा तथा समाधि में वे सब विलीन हो जाती हैं।

All the movements arise one after another, each broken off from the last; and in deep sleep, swoon and absorption they all dissolve.

संधयोऽखिलवृत्तीनामभावाश्चावभासिताः
निर्विकारेण येनासौ कूटस्थ इति चोच्यते ॥ २१ ॥

saṃdhayo'khilavṛttīnāmabhāvāścāvabhāsitāḥ
nirvikāreṇa yenāsau kūṭastha iti cocyate || 21 ||

Samdhayo'khilavrittiinaamabhaavaashchaavabhaasitaah nirvikaarena yenaasau kuutastha iti chochyate

समस्त वृत्तियों की सन्धियाँ और उनके अभाव जिस निर्विकार से भासित होते हैं, वही 'कूटस्थ' कहा जाता है।

That changeless one by which the joins between all the movements and their absences are lit is what is called the unchanging one.

घटे द्विगुणचैतन्यं यथा बाह्ये तथान्तरे
वृत्तिष्वपि ततस्तत्र वैशद्यम् संधितोऽधिकम् ॥ २२ ॥

ghaṭe dviguṇacaitanyaṃ yathā bāhye tathāntare
vṛttiṣvapi tatastatra vaiśadyam saṃdhito'dhikam || 22 ||

Ghate dvigunachaitanyam yathaa baahye tathaantare vrittishvapi tatastatra vaishadyam samdhito'dhikam

जैसे बाहर घड़े में चैतन्य दुगुना होता है, वैसे ही भीतर वृत्तियों में भी; और वहाँ स्पष्टता सन्धि की अपेक्षा अधिक होती है।

As awareness is twofold in the pot outside, so is it in the movements within; and there it is clearer than in the joins.

ज्ञातताज्ञातता न स्तो घटवद्वृत्तिषु क्वचित्
स्वस्य स्वेनागृहीतत्वात्ताभिश्चाज्ञाननाशनम् ॥ २३ ॥

jñātatājñātatā na sto ghaṭavadvṛttiṣu kvacit
svasya svenāgṛhītatvāttābhiścājñānanāśanam || 23 ||

Jnaatataajnaatataa na sto ghatavadvrittishu kvachit svasya svenaagrihiitatvaattaabhishchaajnaananaashanam

घड़े की तरह वृत्तियों में ज्ञातता और अज्ञातता कहीं नहीं होती, क्योंकि वे अपने को अपने से ग्रहण नहीं करतीं, और उन्हीं से अज्ञान का नाश होता है।

Knownness and unknownness, as in the pot, are nowhere in the movements, for they do not grasp themselves by themselves, and it is by them that ignorance is destroyed.

द्विगुणीकृतचैतन्ये जन्मनाशानुभूतितः
अकूटस्थं तदन्यत्तु कूटस्थमविकारतः ॥ २४ ॥

dviguṇīkṛtacaitanye janmanāśānubhūtitaḥ
akūṭasthaṃ tadanyattu kūṭasthamavikārataḥ || 24 ||

Dviguniikritachaitanye janmanaashaanubhuutitah akuutastham tadanyattu kuutasthamavikaaratah

दुगुने किए गए चैतन्य में जन्म और नाश का अनुभव होता है, इसलिए वह अकूटस्थ है; और उससे भिन्न, अविकारी होने से, कूटस्थ है।

In the doubled awareness birth and death are experienced, and so it is not the unchanging one; what is other than it, being changeless, is the unchanging one.

अन्तःकरणतद्वृत्तिसाक्षीत्यादावनेकधा
कूटस्थ एव सर्वत्र पूर्वाचार्यैर्विनिश्चितः ॥ २५ ॥

antaḥkaraṇatadvṛttisākṣītyādāvanekadhā
kūṭastha eva sarvatra pūrvācāryairviniścitaḥ || 25 ||

Antahkaranatadvrittisaakshiityaadaavanekadhaa kuutastha eva sarvatra puurvaachaaryairvinishchitah

'अन्तःकरण और उसकी वृत्तियों का साक्षी' इत्यादि अनेक स्थानों पर पूर्वाचार्यों ने सर्वत्र कूटस्थ का ही निश्चय किया है।

In 'the witness of the inner organ and its movements' and in many such places, the earlier teachers everywhere settled upon the unchanging one.

आत्माभासाश्रयाश्चैवम् मुखाभासाश्रया यथा
गम्यन्ते शास्त्रयुक्तिभ्यामित्याभासश्च वर्णितः ॥ २६ ॥

ātmābhāsāśrayāścaivam mukhābhāsāśrayā yathā
gamyante śāstrayuktibhyāmityābhāsaśca varṇitaḥ || 26 ||

Aatmaabhaasaashrayaashchaivam mukhaabhaasaashrayaa yathaa gamyante shaastrayuktibhyaamityaabhaasashcha varnitah

जैसे मुख के आभास के आश्रय जाने जाते हैं, वैसे ही आत्मा के आभास के आश्रय शास्त्र और युक्ति से जाने जाते हैं — इस प्रकार आभास का वर्णन किया गया।

As the grounds of the face's reflection are known, so the grounds of the Self's reflection are known by scripture and reasoning; thus has the reflection been described.

बुद्ध्यवच्छिन्नकूटस्थो लोकान्तरगमागमौ
कर्तुं शक्तो घटाकाश इवाभासेन किं वद ॥ २७ ॥

buddhyavacchinnakūṭastho lokāntaragamāgamau
kartuṃ śakto ghaṭākāśa ivābhāsena kiṃ vada || 27 ||

Buddhyavachchhinnakuutastho lokaantaragamaagamau kartum shakto ghataakaasha ivaabhaasena kim vada

बुद्धि से अवच्छिन्न कूटस्थ घटाकाश की तरह दूसरे लोकों में आना-जाना कर सकता है; तो बताओ, आभास से क्या प्रयोजन?

The unchanging one bounded by the understanding can go and come between the worlds, as the space in a pot does; then tell us, what need of the reflection?

शृण्वसंगः परिच्छेदमात्रात् जीवो भवेन्न हि
अन्यथा घटकुड्याद्यैरवच्छिन्नस्य जीवता ॥ २८ ॥

śṛṇvasaṃgaḥ paricchedamātrāt jīvo bhavenna hi
anyathā ghaṭakuḍyādyairavacchinnasya jīvatā || 28 ||

Shrinvasamgah parichchhedamaatraat jiivo bhavenna hi anyathaa ghatakudyaadyairavachchhinnasya jiivataa

सुनो — असङ्ग केवल परिच्छेद मात्र से जीव नहीं बन जाता; अन्यथा घड़े और दीवार आदि से अवच्छिन्न को भी जीवत्व हो जाएगा।

Listen — the unattached does not become a soul by mere bounding; otherwise what is bounded by a pot or a wall would be a soul too.

न कुड्यसदृशी बुद्धिः स्वच्छत्वादिति चेत्तथा
अस्तु नाम परिच्छेदे किं स्वाच्छ्येन भवेत्तव ॥ २९ ॥

na kuḍyasadṛśī buddhiḥ svacchatvāditi cettathā
astu nāma paricchede kiṃ svācchyena bhavettava || 29 ||

Na kudyasadrishii buddhih svachchhatvaaditi chettathaa astu naama parichchhede kim svaachchhyena bhavettava

यदि कहो कि बुद्धि दीवार जैसी नहीं, क्योंकि वह स्वच्छ है — तो वैसा ही हो; परिच्छेद के विषय में उसकी स्वच्छता से तुम्हें क्या मिलता है?

If you say that the understanding is not like a wall, being clear — let it be so; but in the matter of bounding, what does its clearness give you?

प्रस्थेन दारुजन्येन कांस्यजन्येन वा न हि
विक्रेतुस्तंडुलादीनां परिमाणं विशिष्यते ॥ ३० ॥

prasthena dārujanyena kāṃsyajanyena vā na hi
vikretustaṃḍulādīnāṃ parimāṇaṃ viśiṣyate || 30 ||

Prasthena daarujanyena kaamsyajanyena vaa na hi vikretustamdulaadiinaam parimaanam vishishyate

काठ के बने प्रस्थ से या काँसे के बने प्रस्थ से, बेचने वाले के चावल आदि का परिमाण भिन्न नहीं होता।

Whether the measure be made of wood or of bell-metal, the quantity of the seller's rice and the rest is not different.

परिमाणाविशेषेऽपि प्रतिबिंबो विशिष्यते
कांस्ये यदि तदा बुद्धावप्याभासो भवेद्बलात् ॥ ३१ ॥

parimāṇāviśeṣe'pi pratibiṃbo viśiṣyate
kāṃsye yadi tadā buddhāvapyābhāso bhavedbalāt || 31 ||

Parimaanaavisheshe'pi pratibimbo vishishyate kaamsye yadi tadaa buddhaavapyaabhaaso bhavedbalaat

यदि परिमाण समान होने पर भी काँसे में प्रतिबिम्ब विशेष होता है, तो बुद्धि में भी आभास बलपूर्वक मानना ही पड़ेगा।

If, the measure being the same, there is yet a reflection in the bell-metal, then a reflection must perforce be admitted in the understanding too.

ईषद्भासनमाभासः प्रतिबिंबस्तथाविधः
बिंबलक्षणहीनस्सन् बिंबवद्भासते स हि ॥ ३२ ॥

īṣadbhāsanamābhāsaḥ pratibiṃbastathāvidhaḥ
biṃbalakṣaṇahīnassan biṃbavadbhāsate sa hi || 32 ||

Iishadbhaasanamaabhaasah pratibimbastathaavidhah bimbalakshanahiinassan bimbavadbhaasate sa hi

थोड़ा-सा भासना आभास है; प्रतिबिम्ब भी वैसा ही है; बिम्ब के लक्षणों से रहित होकर भी वह बिम्ब की तरह भासता है।

A faint shining is the reflection; and the image is of the same kind; lacking the marks of the original, it yet shines like the original.

ससंगत्वविकाराभ्यां बिंबलक्षणहीनता
स्फूर्तिरूपत्वमेतस्य बिंबवद्भासनं विदुः ॥ ३३ ॥

sasaṃgatvavikārābhyāṃ biṃbalakṣaṇahīnatā
sphūrtirūpatvametasya biṃbavadbhāsanaṃ viduḥ || 33 ||

Sasamgatvavikaaraabhyaam bimbalakshanahiinataa sphuurtiruupatvametasya bimbavadbhaasanam viduh

आसक्ति और विकार से युक्त होने के कारण उसमें बिम्ब के लक्षण नहीं हैं; और उसका स्फुरण-रूप होना ही बिम्ब की तरह भासना कहा जाता है।

By its attachment and its change it lacks the marks of the original; and its shining forth is what is called its appearing like the original.

न हि धीभावभावित्वादाभासोऽस्ति धियः पृथक्
इति चेदल्पमेवोक्तं धीरप्येवं स्वदेहतः ॥ ३४ ॥

na hi dhībhāvabhāvitvādābhāso'sti dhiyaḥ pṛthak
iti cedalpamevoktaṃ dhīrapyevaṃ svadehataḥ || 34 ||

Na hi dhiibhaavabhaavitvaadaabhaaso'sti dhiyah prithak iti chedalpamevoktam dhiirapyevam svadehatah

यदि कहो कि बुद्धि के होने पर ही होने से आभास बुद्धि से पृथक् नहीं है — तो यह थोड़ा ही कहा; इसी तरह बुद्धि भी अपने देह से पृथक् नहीं होगी।

If you say that, being only where the understanding is, the reflection is not apart from it — that is too little; in the same way the understanding would not be apart from its own body.

देहे मृतेऽपि बुद्धिश्चेच्छास्त्रादस्ति तथा सति
बुद्धेरन्यश्चिदाभासः प्रवेशश्रुतिषु श्रुतः ॥ ३५ ॥

dehe mṛte'pi buddhiścecchāstrādasti tathā sati
buddheranyaścidābhāsaḥ praveśaśrutiṣu śrutaḥ || 35 ||

Dehe mrite'pi buddhishchechchhaastraadasti tathaa sati buddheranyashchidaabhaasah praveshashrutishu shrutah

यदि शास्त्र से देह के मर जाने पर भी बुद्धि रहती है, तो वैसा होने पर, प्रवेश की श्रुतियों में बुद्धि से भिन्न चिदाभास सुना गया है।

If, on the authority of scripture, the understanding remains even when the body is dead, then in the scriptures of entering, a reflection of awareness distinct from the understanding is declared.

धीयुक्तस्य प्रवेशश्चेन्नैतरेये धियः पृथक्
आत्मा प्रवेशं संकल्प्य प्रविष्ट इति गीयते ॥ ३६ ॥

dhīyuktasya praveśaścennaitareye dhiyaḥ pṛthak
ātmā praveśaṃ saṃkalpya praviṣṭa iti gīyate || 36 ||

Dhiiyuktasya praveshashchennaitareye dhiyah prithak aatmaa pravesham samkalpya pravishta iti giiyate

यदि कहो कि बुद्धि सहित का ही प्रवेश है — तो ऐतरेय में बुद्धि से पृथक् आत्मा ही प्रवेश का संकल्प करके प्रविष्ट हुआ, ऐसा गाया गया है।

If you say it is the one joined with the understanding that enters — in the Aitareya it is sung that the Self, apart from the understanding, resolved on entering and entered.

कथं न्विदं साक्षदेहं मदृते स्यादितीरणात्
विदार्य मूर्धसीमानं प्रविष्टः संसरत्ययम् ॥ ३७ ॥

kathaṃ nvidaṃ sākṣadehaṃ madṛte syāditīraṇāt
vidārya mūrdhasīmānaṃ praviṣṭaḥ saṃsaratyayam || 37 ||

Katham nvidam saakshadeham madrite syaaditiiranaat vidaarya muurdhasiimaanam pravishtah samsaratyayam

'मेरे बिना यह शरीर कैसे रहेगा' — ऐसा कहकर मूर्धा की सीमा को चीरकर वह प्रविष्ट हुआ और संसार में भटकता है।

'How would this body be without me?' — saying so, he clove the crown's boundary, entered, and wanders in the world.

कथं प्रवेशोऽसंगश्चेत् सृष्टिर्वाऽस्य कथं वद
मायिकत्वं तयोस्तुल्यं विनाशश्च समस्तयोः ॥ ३८ ॥

kathaṃ praveśo'saṃgaścet sṛṣṭirvā'sya kathaṃ vada
māyikatvaṃ tayostulyaṃ vināśaśca samastayoḥ || 38 ||

Katham pravesho'samgashchet srishtirvaa'sya katham vada maayikatvam tayostulyam vinaashashcha samastayoh

यदि पूछो कि असङ्ग का प्रवेश कैसे — तो बताओ, इसकी सृष्टि ही कैसे? दोनों का मायिक होना समान है, और दोनों का नाश भी समान है।

If you ask how the unattached can enter, tell us how it can create at all; both alike belong to illusion, and both alike come to an end.

समुत्थायैष भूतेभ्यस्तान्येवानुविनश्यति
विनष्टमिति मैत्रेय्यै याज्ञवल्क्य उवाच हि ॥ ३९ ॥

samutthāyaiṣa bhūtebhyastānyevānuvinaśyati
vinaṣṭamiti maitreyyai yājñavalkya uvāca hi || 39 ||

Samutthaayaisha bhuutebhyastaanyevaanuvinashyati vinashtamiti maitreyyai yaajnavalkya uvaacha hi

'यह भूतों से उठकर उन्हीं के पीछे नष्ट हो जाता है' — याज्ञवल्क्य ने मैत्रेयी से ऐसा कहा।

'Arising out of the elements, it perishes after them' — so Yājñavalkya said to Maitreyī.

अविनाश्ययमात्मेति कूटस्थः प्रविवेचितः
मात्रासंसर्ग इत्येवमसंगत्वस्य कीर्तनात् ॥ ४० ॥

avināśyayamātmeti kūṭasthaḥ pravivecitaḥ
mātrāsaṃsarga ityevamasaṃgatvasya kīrtanāt || 40 ||

Avinaashyayamaatmeti kuutasthah pravivechitah maatraasamsarga ityevamasamgatvasya kiirtanaat

'यह आत्मा अविनाशी है' — इस वचन से कूटस्थ का विवेचन किया गया; और 'मात्रा से संसर्ग नहीं' — इस प्रकार उसकी असङ्गता कही गई।

'This Self is imperishable' — by this the unchanging one was sifted out; and by 'it has no contact with the elements' its unattachedness was declared.

जीवापेतं वाव किल शरीरं म्रियते न सः
इत्यत्र न विमोक्षोऽर्थः किं लोकान्तरे गतिः ॥ ४१ ॥

jīvāpetaṃ vāva kila śarīraṃ mriyate na saḥ
ityatra na vimokṣo'rthaḥ kiṃ lokāntare gatiḥ || 41 ||

Jiivaapetam vaava kila shariiram mriyate na sah ityatra na vimoksho'rthah kim lokaantare gatih

'जीव के निकल जाने पर शरीर मरता है, वह नहीं' — यहाँ अर्थ मोक्ष नहीं है; तो क्या दूसरे लोक में जाना है?

'It is the body forsaken by the living self that dies, not he' — here the meaning is not release; is it then going to another world?

नाहं ब्रह्मेति बुध्येत स विनाशीति चेन्न तत्
सामानाधिकरण्यस्य बाधायामपि संभवात् ॥ ४२ ॥

nāhaṃ brahmeti budhyeta sa vināśīti cenna tat
sāmānādhikaraṇyasya bādhāyāmapi saṃbhavāt || 42 ||

Naaham brahmeti budhyeta sa vinaashiiti chenna tat saamaanaadhikaranyasya baadhaayaamapi sambhavaat

यदि कहो कि वह विनाशी है, इसलिए 'मैं ब्रह्म हूँ' — ऐसा नहीं जान सकेगा — तो नहीं; क्योंकि बाध होने पर भी सामानाधिकरण्य सम्भव है।

If you say that, being perishable, he could not know 'I am Brahman' — not so; for coexistence in one substrate is possible even where there is setting aside.

योऽयं स्थाणुः पुमानेष पुंधिया स्थाणुधीरिव
ब्रह्मास्मीति धियाऽशेषाहंबुद्धिर्निवर्त्यते ॥ ४३ ॥

yo'yaṃ sthāṇuḥ pumāneṣa puṃdhiyā sthāṇudhīriva
brahmāsmīti dhiyā'śeṣāhaṃbuddhirnivartyate || 43 ||

Yo'yam sthaanuh pumaanesha pumdhiyaa sthaanudhiiriva brahmaasmiiti dhiyaa'sheshaahambuddhirnivartyate

'जो यह ठूँठ है वही यह पुरुष है' — जैसे पुरुष की बुद्धि ठूँठ की बुद्धि को हटा देती है, वैसे ही 'मैं ब्रह्म हूँ' इस बुद्धि से समस्त अहंबुद्धि निवृत्त हो जाती है।

'This stump is this man' — as the notion of a man drives out the notion of a stump, so by the conviction 'I am Brahman' the whole sense of 'I' is removed.

नैष्कर्म्यसिद्धावप्येवमाचार्यैः स्पष्टमीरितम्
सामानाधिकरण्यस्य बाधार्थत्वमतोऽस्तु तत् ॥ ४४ ॥

naiṣkarmyasiddhāvapyevamācāryaiḥ spaṣṭamīritam
sāmānādhikaraṇyasya bādhārthatvamato'stu tat || 44 ||

Naishkarmyasiddhaavapyevamaachaaryaih spashtamiiritam saamaanaadhikaranyasya baadhaarthatvamato'stu tat

नैष्कर्म्यसिद्धि में भी आचार्यों ने ऐसा स्पष्ट कहा है; इसलिए सामानाधिकरण्य का बाध-अर्थ होना यहाँ मान लिया जाए।

In the Naiṣkarmyasiddhi too the teachers said this plainly; so let coexistence in one substrate have the sense of setting aside.

सर्वं ब्रह्मेति जगता सामानाधिकरण्यवत्
अहं ब्रह्मेति जीवेन सामानाधिकृतिर्भवेत् ॥ ४५ ॥

sarvaṃ brahmeti jagatā sāmānādhikaraṇyavat
ahaṃ brahmeti jīvena sāmānādhikṛtirbhavet || 45 ||

Sarvam brahmeti jagataa saamaanaadhikaranyavat aham brahmeti jiivena saamaanaadhikritirbhavet

'सब ब्रह्म है' — इस प्रकार जगत् के साथ सामानाधिकरण्य होता है; वैसे ही 'मैं ब्रह्म हूँ' — इस प्रकार जीव के साथ होता है।

'All is Brahman' — so there is coexistence with the world; and so too 'I am Brahman' is a coexistence with the soul.

सामानाधिकरण्यस्य बाधार्थत्वं निराकृतम्
प्रयत्नतो विवरणे कूटस्थस्य विवक्षया ॥ ४६ ॥

sāmānādhikaraṇyasya bādhārthatvaṃ nirākṛtam
prayatnato vivaraṇe kūṭasthasya vivakṣayā || 46 ||

Saamaanaadhikaranyasya baadhaarthatvam niraakritam prayatnato vivarane kuutasthasya vivakshayaa

विवरण में कूटस्थ को कहने की इच्छा से सामानाधिकरण्य के बाध-अर्थ होने का प्रयत्नपूर्वक निराकरण किया गया है।

In the Vivaraṇa, with the intention of speaking of the unchanging one, the sense of setting aside in coexistence was carefully denied.

शोधितस्त्वंपदार्थो यः कूटस्थो ब्रह्मरूपता
तस्य वक्तुम् विवरणे तथोक्तमितरत्र च ॥ ४७ ॥

śodhitastvaṃpadārtho yaḥ kūṭastho brahmarūpatā
tasya vaktum vivaraṇe tathoktamitaratra ca || 47 ||

Shodhitastvampadaartho yah kuutastho brahmaruupataa tasya vaktum vivarane tathoktamitaratra cha

जो शोधित 'त्वम्' पदार्थ कूटस्थ है, उसका ब्रह्म-रूप होना कहने के लिए विवरण में और अन्यत्र भी वैसा कहा गया।

To declare the Brahman-nature of the purified meaning of 'thou', which is the unchanging one, it was so said in the Vivaraṇa and elsewhere.

देहेन्द्रियादियुक्तस्य जीवाभासभ्रमस्य या
अधिष्ठानचितिः सैषा कूटस्थोऽत्र विवक्षिता ॥ ४८ ॥

dehendriyādiyuktasya jīvābhāsabhramasya yā
adhiṣṭhānacitiḥ saiṣā kūṭastho'tra vivakṣitā || 48 ||

Dehendriyaadiyuktasya jiivaabhaasabhramasya yaa adhishthaanachitih saishaa kuutastho'tra vivakshitaa

देह, इन्द्रिय आदि से युक्त जीवाभास के भ्रम की जो अधिष्ठान-चिति है, वही यहाँ 'कूटस्थ' से कही गई है।

The awareness that is the ground of the error of the soul's reflection, joined with body, organs and the rest — that is what is here meant by the unchanging one.

जगद्भ्रमस्य सर्वस्य यदधिष्ठानमीरितम्
त्रय्यन्तेषु तदत्र स्याद्ब्रह्मशब्दविवक्षितम् ॥ ४९ ॥

jagadbhramasya sarvasya yadadhiṣṭhānamīritam
trayyanteṣu tadatra syādbrahmaśabdavivakṣitam || 49 ||

Jagadbhramasya sarvasya yadadhishthaanamiiritam trayyanteshu tadatra syaadbrahmashabdavivakshitam

वेदान्तों में समस्त जगत्-भ्रम का जो अधिष्ठान कहा गया है, वही यहाँ 'ब्रह्म' शब्द से विवक्षित है।

What the Upaniṣads declare to be the ground of the whole world-error is what is here meant by the word 'Brahman'.

एतस्मिन्नेव चैतन्ये जगदारोप्यते यदा
तदा तदेकदेशस्य जीवाभासस्य का कथा ॥ ५० ॥

etasminneva caitanye jagadāropyate yadā
tadā tadekadeśasya jīvābhāsasya kā kathā || 50 ||

Etasminneva chaitanye jagadaaropyate yadaa tadaa tadekadeshasya jiivaabhaasasya kaa kathaa

जब इसी चैतन्य पर जगत् आरोपित किया जाता है, तब उसके एक देश जीवाभास की तो बात ही क्या?

When the world is superimposed upon this very awareness, what need to speak of the soul's reflection, which is but a part of it?

जगत्तदेकदेशाख्यसमारोप्यस्य भेदतः
तत्त्वंपदार्थौ भिन्नौ स्तो वस्तुतस्त्वेकता चितेः ॥ ५१ ॥

jagattadekadeśākhyasamāropyasya bhedataḥ
tattvaṃpadārthau bhinnau sto vastutastvekatā citeḥ || 51 ||

Jagattadekadeshaakhyasamaaropyasya bhedatah tattvampadaarthau bhinnau sto vastutastvekataa chiteh

आरोप्य वस्तु के भेद से — जगत् और उसका एक देश — 'तत्' और 'त्वम्' पदार्थ भिन्न हैं; पर वस्तुतः चिति एक ही है।

By the difference of what is superimposed — the world and a part of it — the meanings of 'That' and 'thou' differ; but in truth awareness is one.

कर्तृत्वादीन् बुद्धिधर्मान् स्फूर्त्याख्यां चात्मरूपताम्
दधद्विभाति पुरत आभासोऽतो भ्रमो भवेत् ॥ ५२ ॥

kartṛtvādīn buddhidharmān sphūrtyākhyāṃ cātmarūpatām
dadhadvibhāti purata ābhāso'to bhramo bhavet || 52 ||

Kartritvaadiin buddhidharmaan sphuurtyaakhyaam chaatmaruupataam dadhadvibhaati purata aabhaaso'to bhramo bhavet

कर्तृत्व आदि बुद्धि के धर्मों को और स्फूर्ति नाम की आत्म-रूपता को धारण करता हुआ आभास सामने भासता है; इसी से भ्रम होता है।

Bearing doership and the other properties of the understanding, and the Self-nature called shining, the reflection appears before us; and from this comes the error.

का बुद्धिः कोऽयमाभासः को वाऽऽत्माऽत्र जगत्कथम्
इत्यनिर्णायतो मोहः सोऽयं संसार इष्यते ॥ ५३ ॥

kā buddhiḥ ko'yamābhāsaḥ ko vā''tmā'tra jagatkatham
ityanirṇāyato mohaḥ so'yaṃ saṃsāra iṣyate || 53 ||

Kaa buddhih ko'yamaabhaasah ko vaa''tmaa'tra jagatkatham ityanirnaayato mohah so'yam samsaara ishyate

'बुद्धि क्या है, यह आभास क्या है, आत्मा क्या है, और जगत् कैसे है?' — इनका निर्णय न होने से जो मोह है, वही संसार माना जाता है।

'What is the understanding, what this reflection, what the Self, and how the world?' — the bewilderment of not settling this is what is held to be the round of the world.

बुद्ध्यादीनां स्वरूपं यो विविनक्ति स तत्त्ववित्
स एव मुक्त इत्येवं वेदान्तेषु विनिश्चयः ॥ ५४ ॥

buddhyādīnāṃ svarūpaṃ yo vivinakti sa tattvavit
sa eva mukta ityevaṃ vedānteṣu viniścayaḥ || 54 ||

Buddhyaadiinaam svaruupam yo vivinakti sa tattvavit sa eva mukta ityevam vedaanteshu vinishchayah

जो बुद्धि आदि के स्वरूप का विवेक करता है वही तत्त्ववेत्ता है, और वही मुक्त है — वेदान्तों में यही निश्चय है।

He who discerns the nature of the understanding and the rest is the knower of truth, and he alone is free — such is the settled view of the Upaniṣads.

एवं च सति बंधः स्यात्कस्येत्यादिकुतर्कजाः
विडंबना दृढं खंड्याः खंडनोक्तिप्रकारतः ॥ ५५ ॥

evaṃ ca sati baṃdhaḥ syātkasyetyādikutarkajāḥ
viḍaṃbanā dṛḍhaṃ khaṃḍyāḥ khaṃḍanoktiprakārataḥ || 55 ||

Evam cha sati bamdhah syaatkasyetyaadikutarkajaah vidambanaa dridham khamdyaah khamdanoktiprakaaratah

ऐसा होने पर 'तो बन्धन किसका होगा' आदि कुतर्कों से उत्पन्न विडम्बनाएँ खण्डन की रीति से दृढ़ता से खण्डित की जानी चाहिए।

This being so, the mockeries born of such bad arguments as 'whose then is the bondage?' should be firmly refuted in the way of refutation.

वृत्तेस्साक्षितया वृत्तिप्रागभावस्य च स्थितः
बुभुत्सायास्तथाऽज्ञोऽस्मीत्याभाताज्ञानवस्तुनः ॥ ५६ ॥

vṛttessākṣitayā vṛttiprāgabhāvasya ca sthitaḥ
bubhutsāyāstathā'jño'smītyābhātājñānavastunaḥ || 56 ||

Vrittessaakshitayaa vrittipraagabhaavasya cha sthitah bubhutsaayaastathaa'jno'smiityaabhaataajnaanavastunah

वृत्ति का, वृत्ति के प्रागभाव का, जानने की इच्छा का, तथा 'मैं अज्ञ हूँ' — इस रूप में भासित अज्ञान-वस्तु का — इन सबका साक्षी होने से वह स्थित है।

He stands as the witness of the mental movement, of its prior absence, of the wish to know, and of the thing that is ignorance, appearing as 'I do not know'.

असत्यालंबनत्वेन सत्यः सर्वजडस्य तु
साधकत्वेन चिद्रूपः सदा प्रेमास्पदत्वतः ॥ ५७ ॥

asatyālaṃbanatvena satyaḥ sarvajaḍasya tu
sādhakatvena cidrūpaḥ sadā premāspadatvataḥ || 57 ||

Asatyaalambanatvena satyah sarvajadasya tu saadhakatvena chidruupah sadaa premaaspadatvatah

असत्य वस्तुओं का आलम्बन होने से वह सत्य है; समस्त जड़ का साधक होने से चिद्रूप है; और सदा प्रेम का आश्रय होने से —

Being the support of unreal things he is real; being what makes all the insentient possible he is awareness; and being ever the seat of love —

आनंदरूपः सर्वार्थसाधकत्वेन हेतुना
सर्वसंबंधवत्वेन संपूर्णः शिवसंज्ञितः ॥ ५८ ॥

ānaṃdarūpaḥ sarvārthasādhakatvena hetunā
sarvasaṃbaṃdhavatvena saṃpūrṇaḥ śivasaṃjñitaḥ || 58 ||

Aanamdaruupah sarvaarthasaadhakatvena hetunaa sarvasambamdhavatvena sampuurnah shivasamjnitah

— आनन्दरूप है; सब अर्थों का साधक होने के कारण, और सब सम्बन्धों वाला होने से, वह सम्पूर्ण है और 'शिव' नाम वाला है।

— he is bliss; being what accomplishes all ends, and having all relations, he is complete, and is named the auspicious.

इति शैवपुराणेषु कूटस्थः प्रविवेचितः
जीवेशत्वादिरहितः केवलः स्वप्रभः शिवः ॥ ५९ ॥

iti śaivapurāṇeṣu kūṭasthaḥ pravivecitaḥ
jīveśatvādirahitaḥ kevalaḥ svaprabhaḥ śivaḥ || 59 ||

Iti shaivapuraaneshu kuutasthah pravivechitah jiiveshatvaadirahitah kevalah svaprabhah shivah

इस प्रकार शैव पुराणों में कूटस्थ का विवेचन किया गया है — जीवत्व और ईश्वरत्व आदि से रहित, केवल, स्वयंप्रकाश शिव।

Thus in the Śaiva lore the unchanging one has been sifted out — free of soulhood and lordship, alone, self-luminous, the auspicious.

मायाभासेन जीवेशौ करोतीति श्रुतत्वतः
मायिकावेव जीवेशौ स्वच्छौ तौ काचकुंभवत् ॥ ६० ॥

māyābhāsena jīveśau karotīti śrutatvataḥ
māyikāveva jīveśau svacchau tau kācakuṃbhavat || 60 ||

Maayaabhaasena jiiveshau karotiiti shrutatvatah maayikaaveva jiiveshau svachchhau tau kaachakumbhavat

'माया के आभास से वह जीव और ईश्वर को बनाता है' — ऐसा सुना गया है; अतः जीव और ईश्वर मायिक ही हैं, और काँच के घड़े की तरह स्वच्छ हैं।

'By the reflection in illusion he makes soul and Lord' — so it is heard; so soul and Lord belong to illusion, and are clear like a glass jar.

अन्नजन्यं मनो देहात्स्वच्छं यद्वत्तथैव तौ
मायिकावपि सर्वस्मादन्यस्मात् स्वच्छतां गतौ ॥ ६१ ॥

annajanyaṃ mano dehātsvacchaṃ yadvattathaiva tau
māyikāvapi sarvasmādanyasmāt svacchatāṃ gatau || 61 ||

Annajanyam mano dehaatsvachchham yadvattathaiva tau maayikaavapi sarvasmaadanyasmaat svachchhataam gatau

जैसे अन्न से उत्पन्न मन देह से स्वच्छ होता है, वैसे ही वे दोनों मायिक होने पर भी सब दूसरी वस्तुओं से स्वच्छ हो गए हैं।

As the mind, born of food, is clearer than the body, so those two, though of illusion, have become clearer than all else.

चिद्रूपत्वं च संभाव्यं चित्त्वेनैव प्रकाशनात्
सर्वकल्पनशक्ताया मायाया दुष्करं न हि ॥ ६२ ॥

cidrūpatvaṃ ca saṃbhāvyaṃ cittvenaiva prakāśanāt
sarvakalpanaśaktāyā māyāyā duṣkaraṃ na hi || 62 ||

Chidruupatvam cha sambhaavyam chittvenaiva prakaashanaat sarvakalpanashaktaayaa maayaayaa dushkaram na hi

और उनका चिद्रूप होना भी सम्भव है, क्योंकि वे चित् के रूप में ही प्रकाशित होते हैं; सब कुछ कल्पित करने में समर्थ माया के लिए कुछ भी कठिन नहीं।

And their being of the nature of awareness is possible too, since they shine as awareness; nothing is hard for illusion, which can imagine everything.

अस्मन्निद्रापि जीवेशौ चेतनौ स्वप्नगौ सृजेत्
महामाया सृजत्येतावित्याश्चर्यं किमत्र ते ॥ ६३ ॥

asmannidrāpi jīveśau cetanau svapnagau sṛjet
mahāmāyā sṛjatyetāvityāścaryaṃ kimatra te || 63 ||

Asmannidraapi jiiveshau chetanau svapnagau srijet mahaamaayaa srijatyetaavityaashcharyam kimatra te

हमारी निद्रा भी स्वप्न में चेतन जीव और ईश्वर रच देती है; महामाया इन्हें रचती है — इसमें तुम्हें क्या आश्चर्य?

Even our sleep creates in dream a conscious soul and Lord; the great illusion creates these — what wonder is there in that for you?

सर्वज्ञत्वादिकं चेशे कल्पयित्वा प्रदर्शयेत्
धर्मिणं कल्पयेद्याऽस्याः को भारो धर्मकल्पने ॥ ६४ ॥

sarvajñatvādikaṃ ceśe kalpayitvā pradarśayet
dharmiṇaṃ kalpayedyā'syāḥ ko bhāro dharmakalpane || 64 ||

Sarvajnatvaadikam cheshe kalpayitvaa pradarshayet dharminam kalpayedyaa'syaah ko bhaaro dharmakalpane

ईश्वर में सर्वज्ञता आदि की भी कल्पना करके वह दिखा देती है; जो धर्मी की ही कल्पना कर लेती है, उसे धर्मों की कल्पना में क्या भार?

It imagines all-knowingness and the rest in the Lord and displays them; what burden is it to imagine qualities for her who imagines the possessor of qualities itself?

कूटस्थेऽप्यतिशंका स्यादिति चेन्मातिशंक्यताम्
कूटस्थमायिकत्वे तु प्रमाणं न हि विद्यते ॥ ६५ ॥

kūṭasthe'pyatiśaṃkā syāditi cenmātiśaṃkyatām
kūṭasthamāyikatve tu pramāṇaṃ na hi vidyate || 65 ||

Kuutasthe'pyatishamkaa syaaditi chenmaatishamkyataam kuutasthamaayikatve tu pramaanam na hi vidyate

यदि कहो कि कूटस्थ में भी ऐसी शङ्का हो सकती है — तो न करो; कूटस्थ के मायिक होने में कोई प्रमाण ही नहीं है।

If you say that the same suspicion may fall on the unchanging one — do not suspect it; there is no proof at all that the unchanging one belongs to illusion.

वस्तुत्वं घोषयन्त्यस्य वेदान्ताः सकला अपि
सपत्नरूपं वस्त्वन्यन्न सहन्तेऽत्र किं च न ॥ ६६ ॥

vastutvaṃ ghoṣayantyasya vedāntāḥ sakalā api
sapatnarūpaṃ vastvanyanna sahante'tra kiṃ ca na || 66 ||

Vastutvam ghoshayantyasya vedaantaah sakalaa api sapatnaruupam vastvanyanna sahante'tra kim cha na

समस्त वेदान्त इसकी वस्तुता की घोषणा करते हैं; वे यहाँ इसके प्रतिद्वन्द्वी किसी और वस्तु को सहन नहीं करते।

All the Upaniṣads proclaim its reality; and here they do not suffer any other thing to stand as its rival.

श्रुत्यर्थं विशदीकुर्मो न तर्कान्वच्मि किंचन
तेन तार्किकशंकानामत्र कोऽवसरो वद ॥ ६७ ॥

śrutyarthaṃ viśadīkurmo na tarkānvacmi kiṃcana
tena tārkikaśaṃkānāmatra ko'vasaro vada || 67 ||

Shrutyartham vishadiikurmo na tarkaanvachmi kimchana tena taarkikashamkaanaamatra ko'vasaro vada

हम श्रुति के अर्थ को स्पष्ट करते हैं, तर्कों से कुछ नहीं कहते; तो बताओ, यहाँ तार्किकों की शङ्काओं का क्या अवसर है?

We make the meaning of scripture clear and say nothing from arguments; tell us then, what occasion is there here for the logicians' doubts?

तस्मात्कुतर्कं सन्त्यज्य मुमुक्षुः श्रुतिमाश्रयेत्
श्रुतौ तु माया जीवेशौ करोतीति प्रदर्शितम् ॥ ६८ ॥

tasmātkutarkaṃ santyajya mumukṣuḥ śrutimāśrayet
śrutau tu māyā jīveśau karotīti pradarśitam || 68 ||

Tasmaatkutarkam santyajya mumukshuh shrutimaashrayet shrutau tu maayaa jiiveshau karotiiti pradarshitam

इसलिए कुतर्क छोड़कर मुमुक्षु को श्रुति का आश्रय लेना चाहिए; और श्रुति में तो 'माया जीव और ईश्वर को बनाती है' — यह दिखाया गया है।

Therefore, giving up bad argument, the seeker of release should take refuge in scripture; and in scripture it is shown that illusion makes soul and Lord.

ईक्षणादिप्रवेशान्ता सृष्टिरीशकृता भवेत्
जाग्रदादिविमोक्षान्तः संसारो जीवकर्तृकः ॥ ६९ ॥

īkṣaṇādipraveśāntā sṛṣṭirīśakṛtā bhavet
jāgradādivimokṣāntaḥ saṃsāro jīvakartṛkaḥ || 69 ||

Iikshanaadipraveshaantaa srishtiriishakritaa bhavet jaagradaadivimokshaantah samsaaro jiivakartrikah

ईक्षण से प्रवेश तक की सृष्टि ईश्वर की की हुई है; और जाग्रत् से मोक्ष तक का संसार जीव का किया हुआ है।

The creation from the first looking to the entering is the Lord's doing; the round from waking to release is the soul's doing.

असंग एव कूटस्थः सर्वदा नास्य कश्चन
भवत्यतिशयस्तेन मनस्येवं विचार्यताम् ॥ ७० ॥

asaṃga eva kūṭasthaḥ sarvadā nāsya kaścana
bhavatyatiśayastena manasyevaṃ vicāryatām || 70 ||

Asamga eva kuutasthah sarvadaa naasya kashchana bhavatyatishayastena manasyevam vichaaryataam

कूटस्थ सदा असङ्ग ही है; इससे उसका कोई अतिशय नहीं होता — मन में इसी का विचार करना चाहिए।

The unchanging one is always unattached; nothing is added to it by all this — let this be weighed in the mind.

न निरोधो न चोत्पत्तिः न बद्धो न च साधकः
न मुमुक्षुर्न वै मुक्त इत्येषा परमार्थता ॥ ७१ ॥

na nirodho na cotpattiḥ na baddho na ca sādhakaḥ
na mumukṣurna vai mukta ityeṣā paramārthatā || 71 ||

Na nirodho na chotpattih na baddho na cha saadhakah na mumukshurna vai mukta ityeshaa paramaarthataa

'न निरोध है, न उत्पत्ति; न कोई बद्ध है, न साधक; न कोई मुमुक्षु है, न मुक्त' — यही परमार्थ है।

'There is no restraining and no arising; none bound and none striving; none seeking release and none released' — this is the highest truth.

अवाङ्मनसगम्यं ते श्रुतिर्बोधयितुं सदा
जीवमीशं जगद्वापि समाश्रित्य प्रबोधयेत् ॥ ७२ ॥

avāṅmanasagamyaṃ te śrutirbodhayituṃ sadā
jīvamīśaṃ jagadvāpi samāśritya prabodhayet || 72 ||

Avaanmanasagamyam te shrutirbodhayitum sadaa jiivamiisham jagadvaapi samaashritya prabodhayet

जो वाणी और मन से अगम्य है, उसे समझाने के लिए श्रुति सदा जीव, ईश्वर या जगत् का आश्रय लेकर बोध कराती है।

To make known what speech and mind cannot reach, scripture always teaches by taking the soul, the Lord or the world as its support.

यया यया भवेत्पुंसां व्युत्पत्तिः प्रत्यगात्मनि
सा सैव प्रक्रियेह स्यात्साध्वीत्याचार्यभाषितम् ॥ ७३ ॥

yayā yayā bhavetpuṃsāṃ vyutpattiḥ pratyagātmani
sā saiva prakriyeha syātsādhvītyācāryabhāṣitam || 73 ||

Yayaa yayaa bhavetpumsaam vyutpattih pratyagaatmani saa saiva prakriyeha syaatsaadhviityaachaaryabhaashitam

'जिस-जिस रीति से मनुष्यों को प्रत्यगात्मा का बोध हो, वही-वही प्रक्रिया यहाँ उत्तम है' — यह आचार्य का वचन है।

'Whatever method brings men to understand the inward Self, that very method is good here' — so the teacher has said.

श्रुतितात्पर्यमखिलमबुद्ध्वा भ्राम्यते जडः
विवेकी त्वखिलं बुद्ध्वा तिष्ठत्यानंदवारिधौ ॥ ७४ ॥

śrutitātparyamakhilamabuddhvā bhrāmyate jaḍaḥ
vivekī tvakhilaṃ buddhvā tiṣṭhatyānaṃdavāridhau || 74 ||

Shrutitaatparyamakhilamabuddhvaa bhraamyate jadah vivekii tvakhilam buddhvaa tishthatyaanamdavaaridhau

श्रुति के समस्त तात्पर्य को न समझकर जड़ भटकता है; और विवेकी सब समझकर आनन्द के समुद्र में स्थित रहता है।

Not understanding the whole purport of scripture, the dull man wanders; but the discerning, understanding it all, abides in the ocean of bliss.

मायामेघो जगन्नीरं वर्षत्येष यथा तथा
चिदाकाशस्य नो हानिर्नवा लाभ इति स्थितिः ॥ ७५ ॥

māyāmegho jagannīraṃ varṣatyeṣa yathā tathā
cidākāśasya no hānirnavā lābha iti sthitiḥ || 75 ||

Maayaamegho jaganniiram varshatyesha yathaa tathaa chidaakaashasya no haanirnavaa laabha iti sthitih

माया-रूपी मेघ जगत्-रूपी जल जैसे भी बरसाए, चिदाकाश की न हानि है न लाभ — यही स्थिति है।

However the cloud of illusion rains the water of the world, the sky of awareness neither loses nor gains — such is the settled truth.

इमं कूटस्थदीपं योऽनुसंधत्ते निरन्तरम्
स्वयम् कूटस्थरूपेण दीप्यतेऽसौ निरन्तरम् ॥ ७६ ॥

imaṃ kūṭasthadīpaṃ yo'nusaṃdhatte nirantaram
svayam kūṭastharūpeṇa dīpyate'sau nirantaram || 76 ||

Imam kuutasthadiipam yo'nusamdhatte nirantaram svayam kuutastharuupena diipyate'sau nirantaram

जो इस 'कूटस्थदीप' का निरन्तर अनुसन्धान करता है, वह स्वयं कूटस्थ के रूप में निरन्तर प्रकाशित होता है।

He who constantly follows out this Lamp of the Unchanging shines himself, without ceasing, as the unchanging one.

संवादिभ्रमवद्ब्रह्मतत्त्वोपास्त्यापि मुच्यते
उत्तरे तापनीयेऽतः श्रुतोपास्तिरनेकधा ॥ १ ॥

saṃvādibhramavadbrahmatattvopāstyāpi mucyate
uttare tāpanīye'taḥ śrutopāstiranekadhā || 1 ||

Samvaadibhramavadbrahmatattvopaastyaapi muchyate uttare taapaniiye'tah shrutopaastiranekadhaa

संवादी भ्रम की तरह ब्रह्म-तत्त्व की उपासना से भी मुक्ति होती है; इसीलिए उत्तर तापनीय में अनेक प्रकार की उपासना सुनी गई है।

As by a truth-yielding error, so by the worship of the reality of Brahman too one is released; and therefore in the latter Tāpanīya worship of many kinds is declared.

मणिप्रदीपप्रभयोर्मणिबुद्ध्याऽभिधावतोः
मिथ्याज्ञानाविशेषेऽपि विशेषोऽर्थक्रियां प्रति ॥ २ ॥

maṇipradīpaprabhayormaṇibuddhyā'bhidhāvatoḥ
mithyājñānāviśeṣe'pi viśeṣo'rthakriyāṃ prati || 2 ||

Manipradiipaprabhayormanibuddhyaa'bhidhaavatoh mithyaajnaanaavisheshe'pi vishesho'rthakriyaam prati

मणि की प्रभा और दीपक की प्रभा — दोनों को मणि समझकर दौड़ने वालों में मिथ्या ज्ञान समान होने पर भी अर्थक्रिया में भेद है।

In two men who run, taking a gem's light and a lamp's light for a gem, the false knowledge is the same, yet they differ in what they get.

दीपोऽपवरकस्यान्तर्वर्तते तत्प्रभा बहिः
दृश्यते द्वार्यथाऽन्यत्र तद्वद्दृष्टा मणेः प्रभा ॥ ३ ॥

dīpo'pavarakasyāntarvartate tatprabhā bahiḥ
dṛśyate dvāryathā'nyatra tadvaddṛṣṭā maṇeḥ prabhā || 3 ||

Diipo'pavarakasyaantarvartate tatprabhaa bahih drishyate dvaaryathaa'nyatra tadvaddrishtaa maneh prabhaa

दीपक कोठरी के भीतर रहता है और उसकी प्रभा बाहर द्वार पर दिखाई देती है; वैसे ही अन्यत्र मणि की प्रभा देखी जाती है।

The lamp is within the chamber and its light is seen outside at the door; and so, elsewhere, the gem's light is seen.

दूरे प्रभाद्वयं दृष्ट्वा मणिबुद्ध्याभिधावतोः
प्रभायां मणिबुद्धिस्तु मिथ्याज्ञानं द्वयोरपि ॥ ४ ॥

dūre prabhādvayaṃ dṛṣṭvā maṇibuddhyābhidhāvatoḥ
prabhāyāṃ maṇibuddhistu mithyājñānaṃ dvayorapi || 4 ||

Duure prabhaadvayam drishtvaa manibuddhyaabhidhaavatoh prabhaayaam manibuddhistu mithyaajnaanam dvayorapi

दूर से दो प्रभाएँ देखकर मणि समझकर दौड़ने वालों में प्रभा में मणि की बुद्धि — यह मिथ्या ज्ञान दोनों में ही है।

In both men, who see the two glows from afar and run taking it for a gem, the notion of a gem in the light is false knowledge alike.

न लभ्यते मणिर्दीपप्रभां प्रत्यभिधावता
प्रभायां धावताऽवश्यं लभ्येतैव मणिर्मणेः ॥ ५ ॥

na labhyate maṇirdīpaprabhāṃ pratyabhidhāvatā
prabhāyāṃ dhāvatā'vaśyaṃ labhyetaiva maṇirmaṇeḥ || 5 ||

Na labhyate manirdiipaprabhaam pratyabhidhaavataa prabhaayaam dhaavataa'vashyam labhyetaiva manirmaneh

दीपक की प्रभा की ओर दौड़ने वाले को मणि नहीं मिलती; पर मणि की प्रभा की ओर दौड़ने वाले को मणि अवश्य मिल जाती है।

He who runs towards the lamp's light does not get a gem; but he who runs towards the gem's light certainly gets the gem.

दीपप्रभामणिभ्रान्तिर्विसंवादिभ्रमः स्मृतः
मणिप्रभा मणिभ्रान्तिः संवादिभ्रम उच्यते ॥ ६ ॥

dīpaprabhāmaṇibhrāntirvisaṃvādibhramaḥ smṛtaḥ
maṇiprabhā maṇibhrāntiḥ saṃvādibhrama ucyate || 6 ||

Diipaprabhaamanibhraantirvisamvaadibhramah smritah maniprabhaa manibhraantih samvaadibhrama uchyate

दीपक की प्रभा में मणि की भ्रान्ति 'विसंवादी भ्रम' कही गई है; और मणि की प्रभा में मणि की भ्रान्ति 'संवादी भ्रम' कही जाती है।

The error of a gem in a lamp's light is called an error that misleads; the error of a gem in a gem's light is called an error that yields the truth.

बाष्पं धूमतया बुद्ध्वा तत्राङ्गारानुमानतः
वह्निर्यदृच्छया लब्धः स संवादिभ्रमो मतः ॥ ७ ॥

bāṣpaṃ dhūmatayā buddhvā tatrāṅgārānumānataḥ
vahniryadṛcchayā labdhaḥ sa saṃvādibhramo mataḥ || 7 ||

Baashpam dhuumatayaa buddhvaa tatraangaaraanumaanatah vahniryadrichchhayaa labdhah sa samvaadibhramo matah

भाप को धुआँ समझकर, वहाँ अंगारों का अनुमान करके, यदि संयोग से अग्नि मिल जाए — वह संवादी भ्रम माना जाता है।

Taking mist for smoke and inferring embers there, if by chance one finds fire — that is held to be an error that yields the truth.

गोदावर्युदकं गङ्गोदकं मत्वा विशुद्धये
संप्रोक्ष्य शुद्धिमाप्नोति स संवादिभ्रमो मतः ॥ ८ ॥

godāvaryudakaṃ gaṅgodakaṃ matvā viśuddhaye
saṃprokṣya śuddhimāpnoti sa saṃvādibhramo mataḥ || 8 ||

Godaavaryudakam gangodakam matvaa vishuddhaye samprokshya shuddhimaapnoti sa samvaadibhramo matah

गोदावरी के जल को गङ्गा-जल मानकर शुद्धि के लिए छिड़ककर यदि शुद्धि मिल जाए — वह संवादी भ्रम माना जाता है।

Taking the Godāvarī's water for the Gaṅgā's and sprinkling it for purity, if one becomes pure — that is held to be an error that yields the truth.

ज्वरेणाप्तः सन्निपातं भ्रान्त्या नारायणं स्मरन्
मृतः स्वर्गमवाप्नोति स संवादिभ्रमो मतः ॥ ९ ॥

jvareṇāptaḥ sannipātaṃ bhrāntyā nārāyaṇaṃ smaran
mṛtaḥ svargamavāpnoti sa saṃvādibhramo mataḥ || 9 ||

Jvarenaaptah sannipaatam bhraantyaa naaraayanam smaran mritah svargamavaapnoti sa samvaadibhramo matah

ज्वर से सन्निपात को प्राप्त होकर, भ्रान्ति से नारायण का स्मरण करता हुआ मरकर यदि कोई स्वर्ग पा ले — वह संवादी भ्रम माना जाता है।

One who in the delirium of fever remembers Nārāyaṇa by mistake and dying gains heaven — that is held to be an error that yields the truth.

प्रत्यक्षस्यानुमानस्य तथा शास्त्रस्य गोचरे
उक्तन्यायेन संवादिभ्रमाः सन्ति हि कोटिशः ॥ १० ॥

pratyakṣasyānumānasya tathā śāstrasya gocare
uktanyāyena saṃvādibhramāḥ santi hi koṭiśaḥ || 10 ||

Pratyakshasyaanumaanasya tathaa shaastrasya gochare uktanyaayena samvaadibhramaah santi hi kotishah

प्रत्यक्ष, अनुमान और शास्त्र — तीनों के विषयों में कही गई रीति से करोड़ों संवादी भ्रम हैं।

In the fields of perception, of inference and of scripture, errors that yield the truth are by the crore, on the rule stated.

अन्यथा मृत्तिकादारुशिलाः स्युर्देवताः कथम्
अग्नित्वादिधियोपास्याः कथं वा योषिदादयः ॥ ११ ॥

anyathā mṛttikādāruśilāḥ syurdevatāḥ katham
agnitvādidhiyopāsyāḥ kathaṃ vā yoṣidādayaḥ || 11 ||

Anyathaa mrittikaadaarushilaah syurdevataah katham agnitvaadidhiyopaasyaah katham vaa yoshidaadayah

अन्यथा मिट्टी, काठ और पत्थर देवता कैसे होते? और अग्नि आदि की बुद्धि से स्त्री आदि उपास्य कैसे होतीं?

Otherwise how could clay, wood and stone be deities? and how could a woman and the rest be worshipped as fire and the like?

अयथावस्तुविज्ञानात्फलं लभ्यत ईप्सितम्
काकतालीयतः सोऽयं संवादिभ्रम उच्यते ॥ १२ ॥

ayathāvastuvijñānātphalaṃ labhyata īpsitam
kākatālīyataḥ so'yaṃ saṃvādibhrama ucyate || 12 ||

Ayathaavastuvijnaanaatphalam labhyata iipsitam kaakataaliiyatah so'yam samvaadibhrama uchyate

वस्तु को यथावत् न जानने पर भी इच्छित फल मिल जाता है; काकतालीय न्याय से यही संवादी भ्रम कहलाता है।

Though the thing is not known as it is, the wished-for fruit is got; by the rule of the crow and the palm-fruit, this is called an error that yields the truth.

स्वयं भ्रमोऽपि संवादी यथा सम्यक्फलप्रदः
ब्रह्मतत्त्वोपासनापि तथा मुक्तिफलप्रदा ॥ १३ ॥

svayaṃ bhramo'pi saṃvādī yathā samyakphalapradaḥ
brahmatattvopāsanāpi tathā muktiphalapradā || 13 ||

Svayam bhramo'pi samvaadii yathaa samyakphalapradah brahmatattvopaasanaapi tathaa muktiphalapradaa

जैसे भ्रम भी संवादी होने पर ठीक फल देता है, वैसे ही ब्रह्म-तत्त्व की उपासना भी मुक्ति का फल देती है।

As even an error, when it yields the truth, gives the right fruit, so the worship of the reality of Brahman gives the fruit of release.

वेदान्तेभ्यो ब्रह्मतत्त्वमखंडैकरसात्मकम्
परोक्षमवगम्यैतदहमस्मीत्युपासते ॥ १४ ॥

vedāntebhyo brahmatattvamakhaṃḍaikarasātmakam
parokṣamavagamyaitadahamasmītyupāsate || 14 ||

Vedaantebhyo brahmatattvamakhamdaikarasaatmakam parokshamavagamyaitadahamasmiityupaasate

वेदान्तों से अखण्ड एकरस-स्वरूप ब्रह्म-तत्त्व को परोक्ष रूप से जानकर, 'यह मैं हूँ' — ऐसी उपासना करते हैं।

Having known indirectly from the Upaniṣads the reality of Brahman, of undivided one taste, they worship it as 'this am I'.

प्रत्यग्व्यक्तिमनुल्लिख्य शास्त्राद्विष्ण्वादिमूर्तिवत्
अस्ति ब्रह्मेति सामान्यज्ञानमत्र परोक्षधीः ॥ १५ ॥

pratyagvyaktimanullikhya śāstrādviṣṇvādimūrtivat
asti brahmeti sāmānyajñānamatra parokṣadhīḥ || 15 ||

Pratyagvyaktimanullikhya shaastraadvishnvaadimuurtivat asti brahmeti saamaanyajnaanamatra parokshadhiih

प्रत्यक् व्यक्ति का उल्लेख किए बिना, शास्त्र से विष्णु आदि की मूर्ति की तरह, 'ब्रह्म है' — यह सामान्य ज्ञान ही यहाँ परोक्ष बुद्धि है।

Without marking the inward particular, the general knowledge 'Brahman is', got from scripture as the form of Viṣṇu and the rest is got, is here the indirect knowledge.

चतुर्भुजाद्यवगतावपि मूर्तिमनुल्लिखन्
अक्षैः परोक्षज्ञान्येव न तदा विष्णुमीक्षते ॥ १६ ॥

caturbhujādyavagatāvapi mūrtimanullikhan
akṣaiḥ parokṣajñānyeva na tadā viṣṇumīkṣate || 16 ||

Chaturbhujaadyavagataavapi muurtimanullikhan akshaih parokshajnaanyeva na tadaa vishnumiikshate

चार भुजाओं आदि का ज्ञान होने पर भी मूर्ति का उल्लेख न करता हुआ वह इन्द्रियों से परोक्ष ज्ञान वाला ही है; उस समय वह विष्णु को देखता नहीं।

Even knowing of the four arms and the rest, so long as he does not mark the form, his knowledge is indirect to the senses; then he does not see Viṣṇu.

परोक्षत्वापराधेन भवेन्नाऽतत्त्ववेदनम्
प्रमाणेनैव शास्त्रेण सत्यमूर्तेर्विभासनात् ॥ १७ ॥

parokṣatvāparādhena bhavennā'tattvavedanam
pramāṇenaiva śāstreṇa satyamūrtervibhāsanāt || 17 ||

Parokshatvaaparaadhena bhavennaa'tattvavedanam pramaanenaiva shaastrena satyamuurtervibhaasanaat

परोक्ष होने के अपराध से वह अतत्त्व का ज्ञान नहीं हो जाता, क्योंकि प्रमाणभूत शास्त्र से ही सत्य मूर्ति का भान होता है।

It does not become knowledge of the untrue merely through the fault of being indirect, since the true form is shown by scripture, which is itself a means of knowledge.

सच्चिदानंदरूपस्य शास्त्राद्भानेऽप्यनुल्लिखन्
प्रत्यंच साक्षिणं तत्तु ब्रह्मसाक्षान्न वीक्षते ॥ १८ ॥

saccidānaṃdarūpasya śāstrādbhāne'pyanullikhan
pratyaṃca sākṣiṇaṃ tattu brahmasākṣānna vīkṣate || 18 ||

Sachchidaanamdaruupasya shaastraadbhaane'pyanullikhan pratyamcha saakshinam tattu brahmasaakshaanna viikshate

सच्चिदानन्द-रूप का शास्त्र से भान होने पर भी, प्रत्यक् साक्षी का उल्लेख न करता हुआ वह ब्रह्म को साक्षात् नहीं देखता।

Though the nature of being, awareness and bliss shines from scripture, so long as he does not mark the inward witness he does not see Brahman directly.

शास्त्रोक्तेनैव मार्गेण सच्चिदानंदनिश्चयात्
परोक्षमपि तज्ज्ञानं तत्त्वज्ञानं न तु भ्रमः ॥ १९ ॥

śāstroktenaiva mārgeṇa saccidānaṃdaniścayāt
parokṣamapi tajjñānaṃ tattvajñānaṃ na tu bhramaḥ || 19 ||

Shaastroktenaiva maargena sachchidaanamdanishchayaat parokshamapi tajjnaanam tattvajnaanam na tu bhramah

शास्त्र के बताए मार्ग से ही सच्चिदानन्द का निश्चय होने से, वह ज्ञान परोक्ष होने पर भी तत्त्वज्ञान है, भ्रम नहीं।

Since the certainty of being, awareness and bliss comes by the path scripture lays down, that knowledge, though indirect, is knowledge of the truth and no error.

ब्रह्म यद्यपि शास्त्रेषु प्रत्यक्त्वेनैव वर्णितम्
महावाक्यैस्तथाऽप्येतद्दुर्बोधमविचारिणः ॥ २० ॥

brahma yadyapi śāstreṣu pratyaktvenaiva varṇitam
mahāvākyaistathā'pyetaddurbodhamavicāriṇaḥ || 20 ||

Brahma yadyapi shaastreshu pratyaktvenaiva varnitam mahaavaakyaistathaa'pyetaddurbodhamavichaarinah

यद्यपि शास्त्रों में महावाक्यों से ब्रह्म का प्रत्यक् रूप ही वर्णित है, तथापि विचार न करने वाले के लिए यह दुर्बोध है।

Though in the scriptures the great sentences describe Brahman as the inward one, yet for him who does not enquire this is hard to grasp.

देहाद्यात्मत्वविभ्रान्तौ जाग्रत्यां न हठात्पुमान्
ब्रह्मात्मत्वेन विज्ञातुं क्षमते मंदधीत्वतः ॥ २१ ॥

dehādyātmatvavibhrāntau jāgratyāṃ na haṭhātpumān
brahmātmatvena vijñātuṃ kṣamate maṃdadhītvataḥ || 21 ||

Dehaadyaatmatvavibhraantau jaagratyaam na hathaatpumaan brahmaatmatvena vijnaatum kshamate mamdadhiitvatah

देह आदि में आत्मबुद्धि की भ्रान्ति के जागते रहने पर, मन्दबुद्धि होने के कारण मनुष्य हठात् ब्रह्म को आत्मा के रूप में नहीं जान पाता।

While the error of taking the body and the rest for the Self is awake, a man of dull mind cannot all at once know Brahman as his Self.

ब्रह्ममात्रं सुविज्ञेयं श्रद्धालोः शास्त्रदर्शिनः
अपरोक्षद्वैतबुद्धिः परोक्षद्वैतबुद्ध्यनुत् ॥ २२ ॥

brahmamātraṃ suvijñeyaṃ śraddhāloḥ śāstradarśinaḥ
aparokṣadvaitabuddhiḥ parokṣadvaitabuddhyanut || 22 ||

Brahmamaatram suvijneyam shraddhaaloh shaastradarshinah aparokshadvaitabuddhih parokshadvaitabuddhyanut

श्रद्धालु और शास्त्र को देखने वाले के लिए केवल ब्रह्म को जानना सुगम है; अपरोक्ष द्वैत की बुद्धि परोक्ष द्वैत की बुद्धि को नहीं हटाती।

For one who has faith and looks to scripture, Brahman alone is easy to know; the direct notion of duality does not drive out the indirect notion of duality.

अपरोक्षशिलाबुद्धिर्न परोक्षेशतां नुदेत्
प्रतिमादिषु विष्णुत्वे को वा विप्रतिपद्यते ॥ २३ ॥

aparokṣaśilābuddhirna parokṣeśatāṃ nudet
pratimādiṣu viṣṇutve ko vā vipratipadyate || 23 ||

Aparokshashilaabuddhirna paroksheshataam nudet pratimaadishu vishnutve ko vaa vipratipadyate

प्रतिमा में पत्थर की अपरोक्ष बुद्धि उसमें परोक्ष ईश्वरता को नहीं हटाती; प्रतिमाओं में विष्णुत्व के विषय में कौन विवाद करता है?

The direct notion of stone in an image does not drive out the indirect lordship in it; who disputes the presence of Viṣṇu in images?

अश्रद्धालोरविश्वासो नोदाहरणमर्हति
श्रद्धालोरेव सर्वत्र वैदिकेष्वधिकारतः ॥ २४ ॥

aśraddhāloraviśvāso nodāharaṇamarhati
śraddhāloreva sarvatra vaidikeṣvadhikārataḥ || 24 ||

Ashraddhaaloravishvaaso nodaaharanamarhati shraddhaaloreva sarvatra vaidikeshvadhikaaratah

अश्रद्धालु का अविश्वास उदाहरण के योग्य नहीं; क्योंकि वैदिक सब बातों में श्रद्धालु का ही अधिकार है।

The unbelief of one without faith is no fit example; for in all things Vedic the right belongs to the man of faith alone.

सकृदाप्तोपदेशेन परोक्षज्ञानमुद्भवेत्
विष्णुमूर्त्युपदेशो हि न मीमांसामपेक्षते ॥ २५ ॥

sakṛdāptopadeśena parokṣajñānamudbhavet
viṣṇumūrtyupadeśo hi na mīmāṃsāmapekṣate || 25 ||

Sakridaaptopadeshena parokshajnaanamudbhavet vishnumuurtyupadesho hi na miimaamsaamapekshate

एक बार आप्त के उपदेश से परोक्ष ज्ञान उत्पन्न हो जाता है; विष्णु की मूर्ति का उपदेश मीमांसा की अपेक्षा नहीं रखता।

Indirect knowledge arises from one instruction of a trustworthy teacher; the teaching of Viṣṇu's form does not wait upon enquiry.

कर्मोपास्ती विचार्येते अनुष्ठेयाविनिर्णयात्
बहुशाखाविप्रकीर्णम् निर्णेतुं कः प्रभुर्नरः ॥ २६ ॥

karmopāstī vicāryete anuṣṭheyāvinirṇayāt
bahuśākhāviprakīrṇam nirṇetuṃ kaḥ prabhurnaraḥ || 26 ||

Karmopaastii vichaaryete anushtheyaavinirnayaat bahushaakhaaviprakiirnam nirnetum kah prabhurnarah

कर्म और उपासना का विचार किया जाता है, क्योंकि वे अनुष्ठेय हैं और उनका निर्णय चाहिए; बहुत शाखाओं में बिखरे हुए का निर्णय करने में कौन मनुष्य समर्थ है?

Rites and worship are enquired into because they are to be performed and must be settled; what man is able to settle what is scattered through many branches?

निर्णीतोऽर्थः कल्पसूत्रैर्ग्रथितस्तावताऽऽस्तिकः
विचारमन्तरेणापि शक्तोऽनुष्ठातुमंजसा ॥ २७ ॥

nirṇīto'rthaḥ kalpasūtrairgrathitastāvatā''stikaḥ
vicāramantareṇāpi śakto'nuṣṭhātumaṃjasā || 27 ||

Nirniito'rthah kalpasuutrairgrathitastaavataa''stikah vichaaramantarenaapi shakto'nushthaatumamjasaa

कल्पसूत्रों में जो अर्थ निर्णीत और ग्रथित है, उतने से आस्तिक विचार के बिना भी सहज ही अनुष्ठान कर सकता है।

What has been settled and set down in the ritual manuals enables a believer to perform with ease, even without enquiry.

उपास्तीनामनुष्ठानमार्षग्रन्थेषु वर्णितम्
विचाराक्षममर्त्याश्च तच्छ्रुत्वोपासते गुरोः ॥ २८ ॥

upāstīnāmanuṣṭhānamārṣagrantheṣu varṇitam
vicārākṣamamartyāśca tacchrutvopāsate guroḥ || 28 ||

Upaastiinaamanushthaanamaarshagrantheshu varnitam vichaaraakshamamartyaashcha tachchhrutvopaasate guroh

उपासनाओं का अनुष्ठान ऋषियों के ग्रन्थों में वर्णित है; और विचार में असमर्थ मनुष्य गुरु से वह सुनकर उपासना करते हैं।

The performance of worship is described in the books of the seers; and men unable to enquire hear it from a teacher and worship.

वेदवाक्यानि निर्णेतुमिच्छन् मीमांसतां जनः
आप्तोपदेशमात्रेण ह्यनुष्ठानं हि संभवेत् ॥ २९ ॥

vedavākyāni nirṇetumicchan mīmāṃsatāṃ janaḥ
āptopadeśamātreṇa hyanuṣṭhānaṃ hi saṃbhavet || 29 ||

Vedavaakyaani nirnetumichchhan miimaamsataam janah aaptopadeshamaatrena hyanushthaanam hi sambhavet

वेद-वाक्यों का निर्णय चाहने वाला मीमांसा करे; पर आप्त के उपदेश मात्र से भी अनुष्ठान सम्भव है।

Let him who wishes to settle the sentences of the Veda enquire; but performance is possible from the instruction of a trustworthy teacher alone.

ब्रह्मसाक्षात्कृतिस्त्वेवं विचारेण विना नृणाम्
आप्तोपदेशमात्रेण न संभवति कुत्रचित् ॥ ३० ॥

brahmasākṣātkṛtistvevaṃ vicāreṇa vinā nṛṇām
āptopadeśamātreṇa na saṃbhavati kutracit || 30 ||

Brahmasaakshaatkritistvevam vichaarena vinaa nrinaam aaptopadeshamaatrena na sambhavati kutrachit

किन्तु ब्रह्म का साक्षात्कार मनुष्यों को विचार के बिना, केवल आप्त के उपदेश से, कहीं भी सम्भव नहीं होता।

But the direct realization of Brahman is nowhere possible for men without enquiry, by the instruction of a trustworthy teacher alone.

परोक्षज्ञानमश्रद्धा प्रतिबध्नाति नेतरत्
अविचारोऽपरोक्षस्य ज्ञानस्य प्रतिबंधकः ॥ ३१ ॥

parokṣajñānamaśraddhā pratibadhnāti netarat
avicāro'parokṣasya jñānasya pratibaṃdhakaḥ || 31 ||

Parokshajnaanamashraddhaa pratibadhnaati netarat avichaaro'parokshasya jnaanasya pratibamdhakah

अश्रद्धा परोक्ष ज्ञान को रोकती है, और कुछ नहीं; और अविचार अपरोक्ष ज्ञान का प्रतिबन्धक है।

Want of faith hinders indirect knowledge and nothing else; want of enquiry hinders direct knowledge.

विचार्याप्यापरोक्ष्येण ब्रह्मात्मानं न वेत्ति चेत्
आपरोक्ष्यावसानत्वाद्भूयो भूयो विचारयेत् ॥ ३२ ॥

vicāryāpyāparokṣyeṇa brahmātmānaṃ na vetti cet
āparokṣyāvasānatvādbhūyo bhūyo vicārayet || 32 ||

Vichaaryaapyaaparokshyena brahmaatmaanam na vetti chet aaparokshyaavasaanatvaadbhuuyo bhuuyo vichaarayet

यदि विचार करके भी कोई ब्रह्मात्मा को अपरोक्ष रूप से न जाने, तो अपरोक्षता में ही उसका अवसान है — इसलिए बार-बार विचार करे।

If even after enquiry one does not know the Self that is Brahman directly, then, since directness is its end, let him enquire again and again.

विचारयन्नामरणं नैवात्मानं लभेत चेत्
जन्मांतरे लभेतैव प्रतिबंधक्षये सति ॥ ३३ ॥

vicārayannāmaraṇaṃ naivātmānaṃ labheta cet
janmāṃtare labhetaiva pratibaṃdhakṣaye sati || 33 ||

Vichaarayannaamaranam naivaatmaanam labheta chet janmaamtare labhetaiva pratibamdhakshaye sati

यदि मरण तक विचार करते हुए भी वह आत्मा को न पाए, तो प्रतिबन्ध के क्षय होने पर दूसरे जन्म में अवश्य पा लेगा।