माण्डूक्योपनिषद्
Mandukya Upanishad
Atharvaveda
Continue exploring ↓ · आगे पढ़ें ↓
The Māṇḍūkya Upaniṣad, of the Atharvaveda, is the shortest of the principal Upaniṣads — twelve prose mantras — and one of the most studied. Its subject is the syllable Oṃ and the Self (ātman), which it treats as one and the same. It begins by saying that Oṃ is everything: past, present and future, and whatever lies beyond time. It then describes the Self as having four quarters, which correspond to the states every person passes through. The first is the waking self, Vaiśvānara, whose awareness faces outward to the physical world; the second is the dreaming self, Taijasa, whose awareness faces inward to a world made by the mind; the third is the self in dreamless sleep, Prājña, a single undivided mass of awareness, full of bliss. The fourth, turīya, is not a further state alongside the others but what underlies all three: not inward, not outward, beyond description, peaceful and non-dual — “that is the Self; that is what is to be known.” The last mantras map these four onto the sounds of Oṃ — A, U and M, and the silence after them. Gauḍapāda’s famous verse commentary, the Māṇḍūkya Kārikā, is a separate work and is not included here. 12 mantras, complete, with the traditional invocation of peace.
अथर्ववेद की माण्डूक्योपनिषद् प्रमुख उपनिषदों में सबसे छोटी है — केवल बारह गद्य मन्त्र — और सबसे अधिक पढ़ी जाने वाली उपनिषदों में से एक। इसका विषय ओंकार और आत्मा है, जिन्हें यह एक ही मानती है। आरम्भ में कहा गया है कि ॐ ही सब कुछ है: भूत, वर्तमान, भविष्य, और जो काल से परे है वह भी। फिर आत्मा को चार पादों वाला बताया गया है, जो उन अवस्थाओं से मेल खाते हैं जिनसे हर व्यक्ति गुज़रता है। पहला जाग्रत् आत्मा वैश्वानर है, जिसकी चेतना बाहर के स्थूल जगत् की ओर है; दूसरा स्वप्न का आत्मा तैजस है, जिसकी चेतना भीतर मन के बनाए जगत् की ओर है; तीसरा गहरी नींद का आत्मा प्राज्ञ है — अविभक्त, घनीभूत चेतना, आनन्द से भरा। चौथा, तुरीय, इन तीनों के साथ एक और अवस्था नहीं, बल्कि तीनों का आधार है: न भीतर की ओर, न बाहर की ओर, अवर्णनीय, शान्त और अद्वैत — “वही आत्मा है, वही जानने योग्य है।” अन्तिम मन्त्र इन चारों को ओंकार की ध्वनियों — अ, उ, म और उनके बाद के मौन — से जोड़ते हैं। गौडपाद की प्रसिद्ध पद्य-व्याख्या, माण्डूक्य-कारिका, एक अलग ग्रन्थ है और यहाँ सम्मिलित नहीं है। सम्पूर्ण उपनिषद्, १२ मन्त्र, पारम्परिक शान्तिपाठ सहित।
Textual source · पाठ-स्रोत
This is the complete Māṇḍūkya Upaniṣad, 12 mantras, with the traditional invocation of peace (भद्रं कर्णेभिः). The Sanskrit follows Sanskrit Wikisource, माण्डुक्योपनिषत्, a public-domain text; the invocation, which that page gives only in part, is given in full from a second transcription on Sanskrit Wikisource. The text has been checked mantra by mantra against that second transcription and against two electronic texts held by GRETIL — the Upaniṣad with the commentary ascribed to Śaṅkara (Sansknet project) and an alternative version entered by Jeff Samuels — none of which is reproduced here. All twelve mantras agree in wording with these texts; the only change is the sandhi सर्वेश्वर एष in mantra 6, as all three comparison texts have it. Gauḍapāda’s Kārikā is not included. The English and Hindi introductions above are original writing by AdiVeda; they give context and summary, not a translation of the Sanskrit and not a traditional commentary.
॥ ॐ ॥
Verse meanings · श्लोकार्थप्रत्येक श्लोक के नीचे दिया गया हिन्दी और अंग्रेज़ी अर्थ AdiVeda का अपना सम्पादकीय अनुवाद है, जो ऊपर दिए गए संस्कृत पाठ से सीधे इस संस्करण के लिए किया गया है। यह पाठ को समझने में सहायता के लिए है — यह किसी प्रकाशित अनुवाद का उद्धरण या कोई पारम्परिक भाष्य नहीं है। जहाँ विभिन्न परम्पराएँ किसी अंश को अलग ढंग से पढ़ती हैं, वहाँ संक्षेप में यह बताया गया है।
The Hindi and English meaning under each verse is AdiVeda's own editorial translation, made directly from the Sanskrit printed here for this edition. It is meant to help you follow the text — it is not quoted from any published translation and it is not a traditional commentary. Where traditions read a passage differently, the meaning says so briefly.
शान्तिपाठः · Invocation of Peace
ॐ भद्रं कर्णेभिः शृणुयाम देवाः भद्रं पश्येमाक्षभिर्यजत्राः ।
स्थिरैरङ्गैस्तुष्टुवाँसस्तनूभिर्व्यशेम देवहितं यदायुः ॥
स्वस्ति न इन्द्रो वृद्धश्रवाः स्वस्ति नः पूषा विश्ववेदाः ।
स्वस्ति नस्तार्क्ष्यो अरिष्टनेमिः स्वस्ति नो बृहस्पतिर्दधातु ॥
ॐ शान्तिः शान्तिः शान्तिः ॥
oṃ bhadraṃ karṇebhiḥ śṛṇuyāma devāḥ bhadraṃ paśyemākṣabhiryajatrāḥ,
sthirairaṅgaistuṣṭuvāṃsastanūbhirvyaśema devahitaṃ yadāyuḥ.
svasti na indro vṛddhaśravāḥ svasti naḥ pūṣā viśvavedāḥ,
svasti nastārkṣyo ariṣṭanemiḥ svasti no bṛhaspatirdadhātu.
oṃ śāntiḥ śāntiḥ śāntiḥ.
Om bhadram karnebhih shrinuyaama devaah bhadram pashyemaakshabhiryajatraah, sthirairangaistushtuvaamsastanuubhirvyashema devahitam yadaayuh. svasti na indro vriddhashravaah svasti nah puushaa vishvavedaah, svasti nastaarkshyo arishtanemih svasti no brihaspatirdadhaatu. om shaantih shaantih shaantih.
हे देवो, हम कानों से कल्याणकारी वचन सुनें; हे पूजनीयो, आँखों से कल्याणकारी दृश्य देखें। स्थिर अंगों और शरीरों से आपकी स्तुति करते हुए हम देवताओं द्वारा निर्धारित आयु भोगें। महान् यश वाले इन्द्र हमारा कल्याण करें; सर्वज्ञ पूषा हमारा कल्याण करें; अरिष्टों को नष्ट करने वाले गरुड़ (तार्क्ष्य) हमारा कल्याण करें; बृहस्पति हमारा कल्याण करें। ॐ शान्ति, शान्ति, शान्ति।
O gods, may we hear with our ears what is good; O holy ones, may we see with our eyes what is good. Praising you with steady limbs and bodies, may we live out the span the gods have set. May Indra of great fame grant us well-being; may Pūṣan who knows all grant us well-being; may Tārkṣya, whose wheel is unharmed, grant us well-being; may Bṛhaspati grant us well-being. Oṃ — peace, peace, peace.
माण्डूक्योपनिषत् · The Upaniṣad (Mantras 1–12)
ॐ इत्येतदक्षरमिदꣳ सर्वं तस्योपव्याख्यानं
भूतं भवद् भविष्यदिति सर्वमोङ्कार एव
यच्चान्यत् त्रिकालातीतं तदप्योङ्कार एव ॥ १ ॥
oṃ ityetadakṣaramidaṃ sarvaṃ tasyopavyākhyānaṃ
bhūtaṃ bhavad bhaviṣyaditi sarvamoṅkāra eva
yaccānyat trikālātītaṃ tadapyoṅkāra eva || 1 ||
Om ityetadaksharamidam sarvam tasyopavyaakhyaanam bhuutam bhavad bhavishyaditi sarvamonkaara eva yachchaanyat trikaalaatiitam tadapyonkaara eva || 1 ||
ॐ — यह अक्षर ही यह सब कुछ है। भूत, वर्तमान और भविष्य — सब इसी का विस्तार (व्याख्यान) है; यह सब ओंकार ही है। और जो तीनों कालों से परे है, वह भी ओंकार ही है।
Oṃ — this syllable is all this. Its explanation is this: what has been, what is and what will be — all of it is simply Oṃ. And whatever else lies beyond the three times, that too is simply Oṃ.
सर्वं ह्येतद् ब्रह्मायमात्मा ब्रह्म सोऽयमात्मा चतुष्पात् ॥ २ ॥
sarvaṃ hyetad brahmāyamātmā brahma so'yamātmā catuṣpāt || 2 ||
Sarvam hyetad brahmaayamaatmaa brahma so'yamaatmaa chatushpaat || 2 ||
यह सब ब्रह्म ही है। यह आत्मा ब्रह्म है। वह यह आत्मा चार पादों (अवस्थाओं) वाला है।
All this is Brahman. This Self is Brahman. This Self has four quarters.
जागरितस्थानो बहिष्प्रज्ञः सप्ताङ्ग एकोनविंशतिमुखः
स्थूलभुग्वैश्वानरः प्रथमः पादः ॥ ३ ॥
jāgaritasthāno bahiṣprajñaḥ saptāṅga ekonaviṃśatimukhaḥ
sthūlabhugvaiśvānaraḥ prathamaḥ pādaḥ || 3 ||
Jaagaritasthaano bahishprajnah saptaanga ekonavimshatimukhah sthuulabhugvaishvaanarah prathamah paadah || 3 ||
जाग्रत् अवस्था जिसका स्थान है, जिसकी चेतना बाहर की ओर है, जो सात अंगों और उन्नीस मुखों वाला है और स्थूल विषयों का भोक्ता है — वह वैश्वानर पहला पाद है।
The first quarter is Vaiśvānara, the universal person: its field is the waking state; its awareness faces outward; it has seven limbs and nineteen mouths; and it enjoys the gross world.
स्वप्नस्थानोऽन्तःप्रज्ञः सप्ताङ्ग एकोनविंशतिमुखः
प्रविविक्तभुक्तैजसो द्वितीयः पादः ॥ ४ ॥
svapnasthāno'ntaḥprajñaḥ saptāṅga ekonaviṃśatimukhaḥ
praviviktabhuktaijaso dvitīyaḥ pādaḥ || 4 ||
Svapnasthaano'ntahprajnah saptaanga ekonavimshatimukhah praviviktabhuktaijaso dvitiiyah paadah || 4 ||
स्वप्न अवस्था जिसका स्थान है, जिसकी चेतना भीतर की ओर है, जो सात अंगों और उन्नीस मुखों वाला है और सूक्ष्म (मानसिक) विषयों का भोक्ता है — वह तैजस (प्रकाशमय) दूसरा पाद है।
The second quarter is Taijasa, the luminous one: its field is dream; its awareness faces inward; it has seven limbs and nineteen mouths; and it enjoys the subtle world of the mind.
यत्र सुप्तो न कञ्चन कामं कामयते न कञ्चन स्वप्नं
पश्यति तत् सुषुप्तम् । सुषुप्तस्थान एकीभूतः प्रज्ञानघन
एवानन्दमयो ह्यानन्दभुक् चेतोमुखः प्राज्ञस्तृतीयः पादः ॥ ५ ॥
yatra supto na kañcana kāmaṃ kāmayate na kañcana svapnaṃ
paśyati tat suṣuptam, suṣuptasthāna ekībhūtaḥ prajñānaghana
evānandamayo hyānandabhuk cetomukhaḥ prājñastṛtīyaḥ pādaḥ || 5 ||
Yatra supto na kanchana kaamam kaamayate na kanchana svapnam pashyati tat sushuptam, sushuptasthaana ekiibhuutah prajnaanaghana evaanandamayo hyaanandabhuk chetomukhah praajnastritiiyah paadah || 5 ||
जहाँ सोया हुआ व्यक्ति न किसी भोग की कामना करता है और न कोई स्वप्न देखता है, वह सुषुप्ति (गहरी नींद) है। सुषुप्ति जिसका स्थान है, जो एकीभूत है, घनीभूत चेतना (प्रज्ञानघन) है, आनन्दमय है, आनन्द का भोक्ता है और चेतना जिसका द्वार है — वह प्राज्ञ तीसरा पाद है।
Where the sleeper desires nothing and sees no dream, that is deep sleep. The third quarter is Prājña, the knower: its field is deep sleep; it has become one; it is a single mass of awareness; it is made of bliss and enjoys bliss; and awareness is its mouth.
एष सर्वेश्वर एष सर्वज्ञ एषोऽन्तर्याम्येष योनिः सर्वस्य
प्रभवाप्ययौ हि भूतानाम् ॥ ६ ॥
eṣa sarveśvara eṣa sarvajña eṣo'ntaryāmyeṣa yoniḥ sarvasya
prabhavāpyayau hi bhūtānām || 6 ||
Esha sarveshvara esha sarvajna esho'ntaryaamyesha yonih sarvasya prabhavaapyayau hi bhuutaanaam || 6 ||
यही सबका ईश्वर है, यही सर्वज्ञ है, यही अन्तर्यामी है, यही सबका मूल कारण (योनि) है; क्योंकि यही प्राणियों की उत्पत्ति और लय का स्थान है।
This is the lord of all; this is the knower of all; this is the inner controller; this is the source of all — for it is the place from which beings arise and into which they dissolve.
नान्तःप्रज्ञं न बहिष्प्रज्ञं नोभयतःप्रज्ञं न प्रज्ञानघनं
न प्रज्ञं नाप्रज्ञम् । अदृष्टमव्यवहार्यमग्राह्यमलक्षणं
अचिन्त्यमव्यपदेश्यमेकात्मप्रत्ययसारं प्रपञ्चोपशमं
शान्तं शिवमद्वैतं चतुर्थं मन्यन्ते स आत्मा स विज्ञेयः ॥ ७ ॥
nāntaḥprajñaṃ na bahiṣprajñaṃ nobhayataḥprajñaṃ na prajñānaghanaṃ
na prajñaṃ nāprajñam, adṛṣṭamavyavahāryamagrāhyamalakṣaṇaṃ
acintyamavyapadeśyamekātmapratyayasāraṃ prapañcopaśamaṃ
śāntaṃ śivamadvaitaṃ caturthaṃ manyante sa ātmā sa vijñeyaḥ || 7 ||
Naantahprajnam na bahishprajnam nobhayatahprajnam na prajnaanaghanam na prajnam naaprajnam, adrishtamavyavahaaryamagraahyamalakshanam achintyamavyapadeshyamekaatmapratyayasaaram prapanchopashamam shaantam shivamadvaitam chaturtham manyante sa aatmaa sa vijneyah || 7 ||
(चौथा पाद) न भीतर की ओर चेतना वाला है, न बाहर की ओर, न दोनों ओर; न घनीभूत चेतना है, न जानने वाला है, न न जानने वाला। वह अदृश्य है, व्यवहार से परे है, पकड़ में न आने वाला, लक्षण-रहित, अचिन्त्य और अवर्णनीय है; एक आत्मा के अनुभव ही जिसका सार है, जिसमें प्रपञ्च (जगत्-विस्तार) शान्त हो जाता है — जो शान्त, शिव और अद्वैत है। उसे चतुर्थ (तुरीय) मानते हैं। वही आत्मा है, वही जानने योग्य है।
Not facing inward, not facing outward, not facing both ways; not a mass of awareness; neither knowing nor unknowing; unseen, beyond dealings, ungraspable, without marks, unthinkable, indescribable; its essence is the certainty of the one Self; in it the world comes to rest; peaceful, auspicious, non-dual — this they consider the fourth (turīya). That is the Self; that is what is to be known.
सोऽयमात्माध्यक्षरमोङ्कारोऽधिमात्रं पादा मात्रा मात्राश्च पादा
अकार उकारो मकार इति ॥ ८ ॥
so'yamātmādhyakṣaramoṅkāro'dhimātraṃ pādā mātrā mātrāśca pādā
akāra ukāro makāra iti || 8 ||
So'yamaatmaadhyaksharamonkaaro'dhimaatram paadaa maatraa maatraashcha paadaa akaara ukaaro makaara iti || 8 ||
वही यह आत्मा अक्षर (अविनाशी शब्द) की दृष्टि से ओंकार है और मात्राओं की दृष्टि से (विभाजित है)। पाद ही मात्राएँ हैं और मात्राएँ ही पाद हैं — अकार, उकार और मकार।
This same Self, seen as a syllable, is Oṃ; seen as sounds, it is divided into measures (mātrās). The quarters are the measures and the measures are the quarters: the sound A, the sound U and the sound M.
जागरितस्थानो वैश्वानरोऽकारः प्रथमा मात्राऽऽप्तेरादिमत्त्वाद्
वाऽऽप्नोति ह वै सर्वान् कामानादिश्च भवति य एवं वेद ॥ ९ ॥
jāgaritasthāno vaiśvānaro'kāraḥ prathamā mātrā''pterādimattvād
vā''pnoti ha vai sarvān kāmānādiśca bhavati ya evaṃ veda || 9 ||
Jaagaritasthaano vaishvaanaro'kaarah prathamaa maatraa''pteraadimattvaad vaa''pnoti ha vai sarvaan kaamaanaadishcha bhavati ya evam veda || 9 ||
जाग्रत् अवस्था वाला वैश्वानर अकार है, पहली मात्रा — क्योंकि (अ) सब में व्याप्त है और सबसे पहले आता है। जो ऐसा जानता है, वह सब कामनाएँ प्राप्त करता है और (सबमें) प्रथम होता है।
Vaiśvānara, whose field is waking, is the sound A, the first measure — because A pervades everything and because it comes first. One who knows this obtains all desires and becomes first.
स्वप्नस्थानस्तैजस उकारो द्वितीया मात्रोत्कर्षात्
उभयत्वाद्वोत्कर्षति ह वै ज्ञानसन्ततिं समानश्च भवति
नास्याब्रह्मवित्कुले भवति य एवं वेद ॥ १० ॥
svapnasthānastaijasa ukāro dvitīyā mātrotkarṣāt
ubhayatvādvotkarṣati ha vai jñānasantatiṃ samānaśca bhavati
nāsyābrahmavitkule bhavati ya evaṃ veda || 10 ||
Svapnasthaanastaijasa ukaaro dvitiiyaa maatrotkarshaat ubhayatvaadvotkarshati ha vai jnaanasantatim samaanashcha bhavati naasyaabrahmavitkule bhavati ya evam veda || 10 ||
स्वप्न अवस्था वाला तैजस उकार है, दूसरी मात्रा — क्योंकि वह (अ से) उत्कृष्ट है और दोनों (अ और म) के बीच में है। जो ऐसा जानता है, उसकी ज्ञान-परम्परा बढ़ती है, वह सबके प्रति समभाव वाला होता है, और उसके कुल में कोई ब्रह्म को न जानने वाला नहीं होता।
Taijasa, whose field is dream, is the sound U, the second measure — because it is higher, and because it stands between the other two. One who knows this raises the line of knowledge, becomes the same to all, and in his family no one is born who does not know Brahman.
सुषुप्तस्थानः प्राज्ञो मकारस्तृतीया मात्रा मितेरपीतेर्वा
मिनोति ह वा इदं सर्वमपीतिश्च भवति य एवं वेद ॥ ११ ॥
suṣuptasthānaḥ prājño makārastṛtīyā mātrā miterapītervā
minoti ha vā idaṃ sarvamapītiśca bhavati ya evaṃ veda || 11 ||
Sushuptasthaanah praajno makaarastritiiyaa maatraa miterapiitervaa minoti ha vaa idam sarvamapiitishcha bhavati ya evam veda || 11 ||
सुषुप्ति अवस्था वाला प्राज्ञ मकार है, तीसरी मात्रा — क्योंकि वह (सबका) माप है और सब उसी में लीन होते हैं। जो ऐसा जानता है, वह इस सबको माप लेता है (यथार्थ जान लेता है) और सबका लय-स्थान बन जाता है।
Prājña, whose field is deep sleep, is the sound M, the third measure — because it is the measure of all, and because all merges into it. One who knows this measures all this and becomes the place where all merges.
अमात्रश्चतुर्थोऽव्यवहार्यः प्रपञ्चोपशमः शिवोऽद्वैत
एवमोङ्कार आत्मैव संविशत्यात्मनाऽऽत्मानं य एवं वेद ॥ १२ ॥
amātraścaturtho'vyavahāryaḥ prapañcopaśamaḥ śivo'dvaita
evamoṅkāra ātmaiva saṃviśatyātmanā''tmānaṃ ya evaṃ veda || 12 ||
Amaatrashchaturtho'vyavahaaryah prapanchopashamah shivo'dvaita evamonkaara aatmaiva samvishatyaatmanaa''tmaanam ya evam veda || 12 ||
मात्रा-रहित (ओंकार) चतुर्थ है — व्यवहार से परे, जिसमें प्रपञ्च शान्त हो जाता है, शिव और अद्वैत। इस प्रकार ओंकार आत्मा ही है। जो ऐसा जानता है, वह अपने आत्मा से आत्मा में प्रवेश कर जाता है।
The fourth is without measure — beyond dealings, the world at rest in it, auspicious, non-dual. Thus Oṃ is the Self itself. One who knows this enters the Self by the Self.
